Talpa occidentalis (Iberian mole): 119243289 Help Entry 119243289         CDS       T07495                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod01521   EGFR tyrosine kinase inhibitor resistance tod01523   Antifolate resistance tod04060   Cytokine-cytokine receptor interaction tod04061   Viral protein interaction with cytokine and cytokine receptor tod04066   HIF-1 signaling pathway tod04068   FoxO signaling pathway tod04151   PI3K-Akt signaling pathway tod04218   Cellular senescence tod04620   Toll-like receptor signaling pathway tod04621   NOD-like receptor signaling pathway tod04623   Cytosolic DNA-sensing pathway tod04625   C-type lectin receptor signaling pathway tod04630   JAK-STAT signaling pathway tod04640   Hematopoietic cell lineage tod04657   IL-17 signaling pathway tod04659   Th17 cell differentiation tod04668   TNF signaling pathway tod04672   Intestinal immune network for IgA production tod04931   Insulin resistance tod04932   Non-alcoholic fatty liver disease tod04933   AGE-RAGE signaling pathway in diabetic complications tod04936   Alcoholic liver disease tod05010   Alzheimer disease tod05020   Prion disease tod05022   Pathways of neurodegeneration - multiple diseases tod05132   Salmonella infection tod05133   Pertussis tod05134   Legionellosis tod05135   Yersinia infection tod05142   Chagas disease tod05143   African trypanosomiasis tod05144   Malaria tod05146   Amoebiasis tod05152   Tuberculosis tod05161   Hepatitis B tod05162   Measles tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05166   Human T-cell leukemia virus 1 infection tod05167   Kaposi sarcoma-associated herpesvirus infection tod05168   Herpes simplex virus 1 infection tod05169   Epstein-Barr virus infection tod05171   Coronavirus disease - COVID-19 tod05200   Pathways in cancer tod05202   Transcriptional misregulation in cancer tod05321   Inflammatory bowel disease tod05323   Rheumatoid arthritis tod05332   Graft-versus-host disease tod05410   Hypertrophic cardiomyopathy tod05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     119243289 (IL6)    04668 TNF signaling pathway     119243289 (IL6)    04066 HIF-1 signaling pathway     119243289 (IL6)    04068 FoxO signaling pathway     119243289 (IL6)    04151 PI3K-Akt signaling pathway     119243289 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119243289 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     119243289 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     119243289 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     119243289 (IL6)    04620 Toll-like receptor signaling pathway     119243289 (IL6)    04621 NOD-like receptor signaling pathway     119243289 (IL6)    04623 Cytosolic DNA-sensing pathway     119243289 (IL6)    04625 C-type lectin receptor signaling pathway     119243289 (IL6)    04659 Th17 cell differentiation     119243289 (IL6)    04657 IL-17 signaling pathway     119243289 (IL6)    04672 Intestinal immune network for IgA production     119243289 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119243289 (IL6)    05202 Transcriptional misregulation in cancer     119243289 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     119243289 (IL6)    05161 Hepatitis B     119243289 (IL6)    05171 Coronavirus disease - COVID-19     119243289 (IL6)    05164 Influenza A     119243289 (IL6)    05162 Measles     119243289 (IL6)    05168 Herpes simplex virus 1 infection     119243289 (IL6)    05163 Human cytomegalovirus infection     119243289 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     119243289 (IL6)    05169 Epstein-Barr virus infection     119243289 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     119243289 (IL6)    05135 Yersinia infection     119243289 (IL6)    05133 Pertussis     119243289 (IL6)    05134 Legionellosis     119243289 (IL6)    05152 Tuberculosis     119243289 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     119243289 (IL6)    05144 Malaria     119243289 (IL6)    05142 Chagas disease     119243289 (IL6)    05143 African trypanosomiasis     119243289 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     119243289 (IL6)    05321 Inflammatory bowel disease     119243289 (IL6)    05332 Graft-versus-host disease     119243289 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     119243289 (IL6)    05020 Prion disease     119243289 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     119243289 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119243289 (IL6)    05410 Hypertrophic cardiomyopathy     119243289 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     119243289 (IL6)    04932 Non-alcoholic fatty liver disease     119243289 (IL6)    04931 Insulin resistance     119243289 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     119243289 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     119243289 (IL6)    01523 Antifolate resistance     119243289 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119243289 (IL6) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Interleukins    119243289 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL23 GCSF Sec16 ABC2_membrane_3 Motif Other DBs NCBI-GeneID:  119243289 NCBI-ProteinID:  XP_037364886 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MSFLSTSVFSPIAISLGLLLVMATAFPTPIPLGEDSKDVILNRAPLTSSNKTEELIKYIL IKISALKNEMCKKYDKCDNNKEALAENNLNLPKMTAKDGCFQSGFNKETCLMRITTGLLD FQIYLEYLQYKFEGDKENAEAVQNSTKALRQILRQKVKNPDALMIPSPTANARLLDELQS QNEWLKNTTIHLTLQSLEDFLQFSLRAIRIM NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atgagcttcctctccacaagcgtcttcagcccaattgccatctccctggggctgctcctg gtgatggctactgcttttcccaccccaatacccctgggagaagattccaaagatgttatc ctaaacagagcaccactcacctcttcaaacaaaaccgaagaactcattaaatacatcctc atcaaaatctctgctctgaaaaatgagatgtgtaaaaagtatgacaagtgtgacaataac aaggaggcactggcagaaaataacctgaaccttccaaaaatgacagcaaaagatggatgc ttccaatctggattcaataaggagacctgcctgatgagaatcaccaccggtcttttggac tttcagatatacctagagtacctccagtataagtttgaaggtgataaggaaaatgccgag gctgtacagaacagtaccaaagccctgagacagatcctaaggcaaaaggtaaagaatcca gatgctctcatgatccctagcccaactgcaaatgccaggctgctagatgaactgcagtca cagaacgaatggttgaaaaacacaacaattcacctcaccctacaaagccttgaggatttc ctgcagttcagcctgagggctattcggataatgtag

DBGET integrated database retrieval system