Talpa occidentalis (Iberian mole): 119243728 Help Entry 119243728         CDS       T07495                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04060   Cytokine-cytokine receptor interaction tod04151   PI3K-Akt signaling pathway tod04630   JAK-STAT signaling pathway tod04640   Hematopoietic cell lineage tod04657   IL-17 signaling pathway tod04658   Th1 and Th2 cell differentiation tod04659   Th17 cell differentiation tod04660   T cell receptor signaling pathway tod04664   Fc epsilon RI signaling pathway tod04672   Intestinal immune network for IgA production tod05140   Leishmaniasis tod05200   Pathways in cancer tod05310   Asthma tod05320   Autoimmune thyroid disease tod05321   Inflammatory bowel disease tod05330   Allograft rejection Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     119243728 (IL4)    04151 PI3K-Akt signaling pathway     119243728 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119243728 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     119243728 (IL4)    04660 T cell receptor signaling pathway     119243728 (IL4)    04658 Th1 and Th2 cell differentiation     119243728 (IL4)    04659 Th17 cell differentiation     119243728 (IL4)    04657 IL-17 signaling pathway     119243728 (IL4)    04664 Fc epsilon RI signaling pathway     119243728 (IL4)    04672 Intestinal immune network for IgA production     119243728 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119243728 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     119243728 (IL4)   09163 Immune disease    05310 Asthma     119243728 (IL4)    05320 Autoimmune thyroid disease     119243728 (IL4)    05321 Inflammatory bowel disease     119243728 (IL4)    05330 Allograft rejection     119243728 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119243728 (IL4)    00536 Glycosaminoglycan binding proteins [BR:tod00536]     119243728 (IL4) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Interleukins    119243728 (IL4) Glycosaminoglycan binding proteins [BR:tod00536]  Heparan sulfate / Heparin   Cytokines    119243728 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 AAR2 Motif Other DBs NCBI-GeneID:  119243728 NCBI-ProteinID:  XP_037365557 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MGLTAQLIPTLICLLVCTSNFVLGHKFDLTLKEIIKALNILTERKDACMELTVADVFATS KNTTEKEIFCRATIVLRQFYRHHKCLPKLVKGLSRNISSMANMPYCPVNEAKKNTLKDFL ERLKTIMQEKYSKS NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgggtctcactgcccaactgattccaactctgatctgtttattagtatgtaccagcaat ttcgtcctcggacacaaatttgatcttaccctaaaagagatcatcaaagcgctgaacatc ctcacagagagaaaggatgcatgcatggagctcaccgtagcagatgtctttgccacctca aagaacacaactgagaaggaaatcttctgcagggccacaattgtgcttcggcagttctac agacaccacaagtgcttacccaaacttgtgaaaggactcagcagaaacatcagcagcatg gcaaacatgccctactgccctgtgaatgaagccaagaagaatacgttgaaagacttcttg gaaaggctaaagacgatcatgcaagagaaatactcaaagagttga

DBGET integrated database retrieval system