Talpa occidentalis (Iberian mole): 119245306 Help Entry 119245306         CDS       T07495                                  Symbol PLA2G1B Name (RefSeq) phospholipase A2   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism tod  Talpa occidentalis (Iberian mole) Pathway tod00564   Glycerophospholipid metabolism tod00565   Ether lipid metabolism tod00590   Arachidonic acid metabolism tod00591   Linoleic acid metabolism tod00592   alpha-Linolenic acid metabolism tod01100   Metabolic pathways tod04014   Ras signaling pathway tod04270   Vascular smooth muscle contraction tod04972   Pancreatic secretion tod04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:tod00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     119245306 (PLA2G1B)    00565 Ether lipid metabolism     119245306 (PLA2G1B)    00590 Arachidonic acid metabolism     119245306 (PLA2G1B)    00591 Linoleic acid metabolism     119245306 (PLA2G1B)    00592 alpha-Linolenic acid metabolism     119245306 (PLA2G1B)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     119245306 (PLA2G1B)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     119245306 (PLA2G1B)   09154 Digestive system    04972 Pancreatic secretion     119245306 (PLA2G1B)    04975 Fat digestion and absorption     119245306 (PLA2G1B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tod03036]     119245306 (PLA2G1B) Enzymes [BR:tod01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      119245306 (PLA2G1B) Chromosome and associated proteins [BR:tod03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     119245306 (PLA2G1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_4 Motif Other DBs NCBI-GeneID:  119245306 NCBI-ProteinID:  XP_037367427 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MKVLVLAALLSVAAAESSEDSRSVLQLRQMIKCTIPDSNPALDFADYGCYCGLGGYGTPV DALDRCCQVHDECYSKSRKLESCRYILDNPYTRRYSFSCSGTEVTCNSSKNNECQEFLCN CDRTAAICFSQSPYNKEYHNLDLDKFCQK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtcctcgtgcttgccgctctgctctcagtggccgctgcggagagcagcgaagac tcacggtcagtgctgcaactccgccaaatgatcaagtgcacgatccccgacagtaacccg gcgctggacttcgctgactacggctgctactgcggcctgggaggatacggcacccccgtg gatgccctggacaggtgctgccaggtacacgacgaatgctactcgaaatccaggaaattg gaaagctgtagatatatcctggacaacccctacaccagaagatactcgttctcatgctct ggcacagaggtcacctgcaacagcagtaaaaacaatgagtgccaggaattcctctgcaat tgtgaccgcactgctgccatctgcttttcccagtccccatataacaaagaataccacaat ctggatctcgacaagttctgtcagaaataa

DBGET integrated database retrieval system