Talpa occidentalis (Iberian mole): 119247531 Help Entry 119247531         CDS       T07495                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04010   MAPK signaling pathway tod04014   Ras signaling pathway tod04015   Rap1 signaling pathway tod04024   cAMP signaling pathway tod04062   Chemokine signaling pathway tod04510   Focal adhesion tod04520   Adherens junction tod04611   Platelet activation tod04670   Leukocyte transendothelial migration tod04720   Long-term potentiation tod04722   Neurotrophin signaling pathway tod04934   Cushing syndrome tod04972   Pancreatic secretion tod05211   Renal cell carcinoma tod05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119247531 (RAP1B)    04014 Ras signaling pathway     119247531 (RAP1B)    04015 Rap1 signaling pathway     119247531 (RAP1B)    04024 cAMP signaling pathway     119247531 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     119247531 (RAP1B)    04520 Adherens junction     119247531 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     119247531 (RAP1B)    04670 Leukocyte transendothelial migration     119247531 (RAP1B)    04062 Chemokine signaling pathway     119247531 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     119247531 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     119247531 (RAP1B)    04722 Neurotrophin signaling pathway     119247531 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     119247531 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119247531 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     119247531 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tod04147]     119247531 (RAP1B)    04031 GTP-binding proteins [BR:tod04031]     119247531 (RAP1B) Exosome [BR:tod04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    119247531 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    119247531 (RAP1B)   Exosomal proteins of colorectal cancer cells    119247531 (RAP1B) GTP-binding proteins [BR:tod04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     119247531 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  119247531 NCBI-ProteinID:  XP_037369922 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctggtggttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgtccaaggaatttttgttgaaaaatatgatcctacaatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttacagcaatgagggatttgtacatgaaaaatggacaaggctttgcttta gtttattccatcacagcacagtctacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggagcaaggtcaaaatctagcaagacaatggaacaac tgtgcgttcttagaatcctctgcaaagtcaaaaataaacgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctggaaaggcccgcaaaaagtcatca tgtcagctgctttaa

DBGET integrated database retrieval system