Talpa occidentalis (Iberian mole): 119248102 Help Entry 119248102         CDS       T07495                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism tod  Talpa occidentalis (Iberian mole) Pathway tod01522   Endocrine resistance tod04110   Cell cycle tod04115   p53 signaling pathway tod04151   PI3K-Akt signaling pathway tod04218   Cellular senescence tod04530   Tight junction tod04660   T cell receptor signaling pathway tod04933   AGE-RAGE signaling pathway in diabetic complications tod04934   Cushing syndrome tod05160   Hepatitis C tod05162   Measles tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05165   Human papillomavirus infection tod05166   Human T-cell leukemia virus 1 infection tod05167   Kaposi sarcoma-associated herpesvirus infection tod05169   Epstein-Barr virus infection tod05200   Pathways in cancer tod05203   Viral carcinogenesis tod05212   Pancreatic cancer tod05214   Glioma tod05218   Melanoma tod05219   Bladder cancer tod05220   Chronic myeloid leukemia tod05222   Small cell lung cancer tod05223   Non-small cell lung cancer tod05224   Breast cancer tod05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     119248102 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     119248102 (CDK4)    04115 p53 signaling pathway     119248102 (CDK4)    04218 Cellular senescence     119248102 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     119248102 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     119248102 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119248102 (CDK4)    05203 Viral carcinogenesis     119248102 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     119248102 (CDK4)    05225 Hepatocellular carcinoma     119248102 (CDK4)    05214 Glioma     119248102 (CDK4)    05220 Chronic myeloid leukemia     119248102 (CDK4)    05218 Melanoma     119248102 (CDK4)    05219 Bladder cancer     119248102 (CDK4)    05224 Breast cancer     119248102 (CDK4)    05222 Small cell lung cancer     119248102 (CDK4)    05223 Non-small cell lung cancer     119248102 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     119248102 (CDK4)    05160 Hepatitis C     119248102 (CDK4)    05164 Influenza A     119248102 (CDK4)    05162 Measles     119248102 (CDK4)    05163 Human cytomegalovirus infection     119248102 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     119248102 (CDK4)    05169 Epstein-Barr virus infection     119248102 (CDK4)    05165 Human papillomavirus infection     119248102 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     119248102 (CDK4)    04934 Cushing syndrome     119248102 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     119248102 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:tod01001]     119248102 (CDK4) Enzymes [BR:tod01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      119248102 (CDK4) Protein kinases [BR:tod01001]  Serine/threonine kinases: CMGC group   CDK family    119248102 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo APH ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  119248102 NCBI-ProteinID:  XP_037370978 LinkDB All DBs Position Unknown AA seq 302 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGDGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MCQFLRGLEFLHANSIVHRDLKPENILVTSSGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRRPLFCGNSEADQLGKIFDLIGLPPEEDWPR DVSLPRGAFSPRGPRPVQSVVPEMEEAGAQLLLEMLAFNPHKRISALRALQHCYLQKEGN PE NT seq 909 nt NT seq  +upstreamnt  +downstreamnt atggctacctcgcgatacgagccagtggccgagattggcgtcggtgcctatgggactgtg tacaaagcccgcgaccctcacagtggccactttgtggccctcaagagcgtgagagtcccc aacggagacggtgctggagggggcctccccatcagcacagtgcgggaggttgcgttactg aggcgactggaggcttttgagcatcctaatgtggtccggctgatggacgtctgcgccact gcacgaacggatcgggagaccaaagtgaccctggtgtttgagcatgtggaccaggacctc aggacgtatctggacaaggcacccccgccaggcttgccagtggagaccattaaggatctg atgtgccagtttctaagaggcctagaattccttcatgccaacagcatcgtccaccgagac ctgaagccagagaacattctggtgacaagcagtggaacagtcaagctggctgacttcggc ctagccaggatctacagctaccagatggcgctcacaccagtggttgtgacactctggtac cgggccccggaggtgcttctgcagtctacgtatgcaacacccgtggacatgtggagcgtt ggctgtatctttgcagagatgttccgccgaaggcctctcttctgtggaaactctgaagct gaccagttgggcaagatctttgacctgattgggctgccgccagaagaggactggccccga gatgtgtctctgccccgcggagccttttcccccagagggccccgcccagtgcagtctgtg gtgcccgagatggaggaggctggagcgcagctgctgctggagatgctggcttttaaccca cacaagcgaatctctgctctccgagccctgcagcactgttacctacaaaaagaaggtaac ccagagtga

DBGET integrated database retrieval system