Talpa occidentalis (Iberian mole): 119248294 Help Entry 119248294         CDS       T07495                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism tod  Talpa occidentalis (Iberian mole) Pathway tod03050   Proteasome tod04060   Cytokine-cytokine receptor interaction tod04066   HIF-1 signaling pathway tod04217   Necroptosis tod04350   TGF-beta signaling pathway tod04380   Osteoclast differentiation tod04612   Antigen processing and presentation tod04630   JAK-STAT signaling pathway tod04650   Natural killer cell mediated cytotoxicity tod04657   IL-17 signaling pathway tod04658   Th1 and Th2 cell differentiation tod04659   Th17 cell differentiation tod04660   T cell receptor signaling pathway tod04940   Type I diabetes mellitus tod05140   Leishmaniasis tod05142   Chagas disease tod05143   African trypanosomiasis tod05144   Malaria tod05145   Toxoplasmosis tod05146   Amoebiasis tod05152   Tuberculosis tod05160   Hepatitis C tod05164   Influenza A tod05168   Herpes simplex virus 1 infection tod05200   Pathways in cancer tod05235   PD-L1 expression and PD-1 checkpoint pathway in cancer tod05321   Inflammatory bowel disease tod05322   Systemic lupus erythematosus tod05323   Rheumatoid arthritis tod05330   Allograft rejection tod05332   Graft-versus-host disease tod05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     119248294 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     119248294 (IFNG)    04630 JAK-STAT signaling pathway     119248294 (IFNG)    04066 HIF-1 signaling pathway     119248294 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119248294 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     119248294 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     119248294 (IFNG)    04612 Antigen processing and presentation     119248294 (IFNG)    04660 T cell receptor signaling pathway     119248294 (IFNG)    04658 Th1 and Th2 cell differentiation     119248294 (IFNG)    04659 Th17 cell differentiation     119248294 (IFNG)    04657 IL-17 signaling pathway     119248294 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     119248294 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     119248294 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     119248294 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     119248294 (IFNG)    05164 Influenza A     119248294 (IFNG)    05168 Herpes simplex virus 1 infection     119248294 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     119248294 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     119248294 (IFNG)    05144 Malaria     119248294 (IFNG)    05145 Toxoplasmosis     119248294 (IFNG)    05140 Leishmaniasis     119248294 (IFNG)    05142 Chagas disease     119248294 (IFNG)    05143 African trypanosomiasis     119248294 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     119248294 (IFNG)    05323 Rheumatoid arthritis     119248294 (IFNG)    05321 Inflammatory bowel disease     119248294 (IFNG)    05330 Allograft rejection     119248294 (IFNG)    05332 Graft-versus-host disease     119248294 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     119248294 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     119248294 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:tod03051]     119248294 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119248294 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:tod00536]     119248294 (IFNG) Proteasome [BR:tod03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     119248294 (IFNG) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Interferons    119248294 (IFNG) Glycosaminoglycan binding proteins [BR:tod00536]  Heparan sulfate / Heparin   Cytokines    119248294 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma Tup_N PSD13_N Motif Other DBs NCBI-GeneID:  119248294 NCBI-ProteinID:  XP_037371154 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MNYTSCILALQLCVLLGSSTYCCQVSCIEEIDNLKDYFNASTSDVPDGRYLFRDILKNWK EDSDKKIIQSQIVSFYFKLFNNYKDNQIIQTSMENIKANMVSMFFNSTNRSSDSKREDFE KLMDIQVNDLKVQRKAISELQSVMSDLSSRSNLRKRRRSQIQIQGRRASK NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaagctgtatcttagctttgcagctttgtgtgcttttgggttcatctacc tattgctgccaggtttcatgtattgaggaaatagacaacctaaaggactattttaatgca agtacttcagatgtaccagatggtaggtatcttttcagagatattttgaagaattggaaa gaggacagtgacaaaaaaataattcagagccaaatcgtgtccttctacttcaaactcttt aacaattataaagacaaccagatcatccaaacaagcatggaaaacatcaaggcaaacatg gtctctatgttcttcaatagcaccaacagaagcagcgacagcaaacgggaggacttcgaa aagctgatggatattcaggtcaatgatctgaaggttcagcgcaaagcaataagtgagctc caatctgtgatgagtgatctgtcatcaagatctaacctaaggaagcggagaaggagtcaa attcagattcaaggccggagagcatcaaaataa

DBGET integrated database retrieval system