Talpa occidentalis (Iberian mole): 119253235 Help Entry 119253235         CDS       T07495                                  Symbol TNF Name (RefSeq) tumor necrosis factor isoform X1   KO K03156   tumor necrosis factor superfamily, member 2 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod01523   Antifolate resistance tod04010   MAPK signaling pathway tod04060   Cytokine-cytokine receptor interaction tod04061   Viral protein interaction with cytokine and cytokine receptor tod04064   NF-kappa B signaling pathway tod04071   Sphingolipid signaling pathway tod04150   mTOR signaling pathway tod04210   Apoptosis tod04217   Necroptosis tod04350   TGF-beta signaling pathway tod04380   Osteoclast differentiation tod04612   Antigen processing and presentation tod04620   Toll-like receptor signaling pathway tod04621   NOD-like receptor signaling pathway tod04622   RIG-I-like receptor signaling pathway tod04625   C-type lectin receptor signaling pathway tod04640   Hematopoietic cell lineage tod04650   Natural killer cell mediated cytotoxicity tod04657   IL-17 signaling pathway tod04660   T cell receptor signaling pathway tod04664   Fc epsilon RI signaling pathway tod04668   TNF signaling pathway tod04920   Adipocytokine signaling pathway tod04930   Type II diabetes mellitus tod04931   Insulin resistance tod04932   Non-alcoholic fatty liver disease tod04933   AGE-RAGE signaling pathway in diabetic complications tod04936   Alcoholic liver disease tod04940   Type I diabetes mellitus tod05010   Alzheimer disease tod05014   Amyotrophic lateral sclerosis tod05020   Prion disease tod05022   Pathways of neurodegeneration - multiple diseases tod05132   Salmonella infection tod05133   Pertussis tod05134   Legionellosis tod05135   Yersinia infection tod05140   Leishmaniasis tod05142   Chagas disease tod05143   African trypanosomiasis tod05144   Malaria tod05145   Toxoplasmosis tod05146   Amoebiasis tod05152   Tuberculosis tod05160   Hepatitis C tod05161   Hepatitis B tod05163   Human cytomegalovirus infection tod05164   Influenza A tod05165   Human papillomavirus infection tod05166   Human T-cell leukemia virus 1 infection tod05168   Herpes simplex virus 1 infection tod05169   Epstein-Barr virus infection tod05170   Human immunodeficiency virus 1 infection tod05171   Coronavirus disease - COVID-19 tod05205   Proteoglycans in cancer tod05310   Asthma tod05321   Inflammatory bowel disease tod05322   Systemic lupus erythematosus tod05323   Rheumatoid arthritis tod05330   Allograft rejection tod05332   Graft-versus-host disease tod05410   Hypertrophic cardiomyopathy tod05414   Dilated cardiomyopathy tod05417   Lipid and atherosclerosis tod05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     119253235 (TNF)    04350 TGF-beta signaling pathway     119253235 (TNF)    04064 NF-kappa B signaling pathway     119253235 (TNF)    04668 TNF signaling pathway     119253235 (TNF)    04071 Sphingolipid signaling pathway     119253235 (TNF)    04150 mTOR signaling pathway     119253235 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119253235 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     119253235 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     119253235 (TNF)    04217 Necroptosis     119253235 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     119253235 (TNF)    04620 Toll-like receptor signaling pathway     119253235 (TNF)    04621 NOD-like receptor signaling pathway     119253235 (TNF)    04622 RIG-I-like receptor signaling pathway     119253235 (TNF)    04625 C-type lectin receptor signaling pathway     119253235 (TNF)    04650 Natural killer cell mediated cytotoxicity     119253235 (TNF)    04612 Antigen processing and presentation     119253235 (TNF)    04660 T cell receptor signaling pathway     119253235 (TNF)    04657 IL-17 signaling pathway     119253235 (TNF)    04664 Fc epsilon RI signaling pathway     119253235 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     119253235 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     119253235 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     119253235 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     119253235 (TNF)    05170 Human immunodeficiency virus 1 infection     119253235 (TNF)    05161 Hepatitis B     119253235 (TNF)    05160 Hepatitis C     119253235 (TNF)    05171 Coronavirus disease - COVID-19     119253235 (TNF)    05164 Influenza A     119253235 (TNF)    05168 Herpes simplex virus 1 infection     119253235 (TNF)    05163 Human cytomegalovirus infection     119253235 (TNF)    05169 Epstein-Barr virus infection     119253235 (TNF)    05165 Human papillomavirus infection     119253235 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     119253235 (TNF)    05135 Yersinia infection     119253235 (TNF)    05133 Pertussis     119253235 (TNF)    05134 Legionellosis     119253235 (TNF)    05152 Tuberculosis     119253235 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     119253235 (TNF)    05144 Malaria     119253235 (TNF)    05145 Toxoplasmosis     119253235 (TNF)    05140 Leishmaniasis     119253235 (TNF)    05142 Chagas disease     119253235 (TNF)    05143 African trypanosomiasis     119253235 (TNF)   09163 Immune disease    05310 Asthma     119253235 (TNF)    05322 Systemic lupus erythematosus     119253235 (TNF)    05323 Rheumatoid arthritis     119253235 (TNF)    05321 Inflammatory bowel disease     119253235 (TNF)    05330 Allograft rejection     119253235 (TNF)    05332 Graft-versus-host disease     119253235 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     119253235 (TNF)    05014 Amyotrophic lateral sclerosis     119253235 (TNF)    05020 Prion disease     119253235 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     119253235 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119253235 (TNF)    05418 Fluid shear stress and atherosclerosis     119253235 (TNF)    05410 Hypertrophic cardiomyopathy     119253235 (TNF)    05414 Dilated cardiomyopathy     119253235 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     119253235 (TNF)    04940 Type I diabetes mellitus     119253235 (TNF)    04936 Alcoholic liver disease     119253235 (TNF)    04932 Non-alcoholic fatty liver disease     119253235 (TNF)    04931 Insulin resistance     119253235 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     119253235 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     119253235 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119253235 (TNF)    00536 Glycosaminoglycan binding proteins [BR:tod00536]     119253235 (TNF) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Tumor necrosis fators    119253235 (TNF) Glycosaminoglycan binding proteins [BR:tod00536]  Heparan sulfate / Heparin   Cytokines    119253235 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  119253235 NCBI-ProteinID:  XP_037376733 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSTESMIRDVELAEEELSKKAGSPQGSRRCWCISLFFLLIAGATTLFCLLHFGVIGPQGE EQHPNTLPLLNTLAQTLRSSSRTPGDKPVAHVVANPQAEGQLQWLSQVANALLANGVELT NNQLVVPSDGLYLIYSQVLFKGQGCPSNLVLLTHKIQRTAVSYEDAVDLLSAIKSPCQRE TPEGAEARPWYEPIYLGGVFQLEKGDRLSANINLPKYLDFAQSGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcaccgaaagcatgatccgggatgtggagctggctgaggaggagctctccaagaag gcaggaagcccccagggctccagaaggtgttggtgcatcagcctcttctttctcctcata gcaggagccactacactcttttgcctgctgcacttcggggtgatcggtccccagggggaa gagcagcacccaaataccctgccgctgctcaacactctggcccagacactcagatcatct tctcgaaccccaggtgacaagcctgtggcccatgttgtagcaaacccccaagctgagggg cagctccaatggctgagtcaggtcgccaacgccctcctggccaacggagttgagctgaca aacaaccagctggtggtcccttcggacgggctatacctcatctactcccaggttctcttc aagggccaaggctgcccttccaacctcgtgctcctcacccacaaaatccaacgcactgct gtctcctacgaggatgcggtcgacctcctctctgccatcaaaagcccttgccagagggag acccccgagggggcagaggccaggccctggtatgagcccatctacttgggaggggtcttc caactggagaagggggaccgactcagtgctaatatcaatctgcccaagtatctcgacttt gcccagtctggacaggtctactttgggatcatcgccctatga

DBGET integrated database retrieval system