Thrips palmi (melon thrips): 117653007 Help Entry 117653007         CDS       T08251                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism tpal  Thrips palmi (melon thrips) Pathway tpal00510   N-Glycan biosynthesis tpal00513   Various types of N-glycan biosynthesis tpal04141   Protein processing in endoplasmic reticulum Module tpal_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:tpal00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     117653007    00513 Various types of N-glycan biosynthesis     117653007  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117653007 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  117653007 NCBI-ProteinID:  XP_034254229 UniProt:  A0A6P9AA55 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MDIELMSRYVSPVNPAVFPHLTIVLLGIGIFFTAWFFVYEVTSTKYTRDVFKELLVALVA AIFSGMGMLFLMLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacatagaacttatgtcaagatatgtttcacctgtcaacccagcagtctttccccat ttgacaattgtcctgctcggcatcggaattttcttcactgcttggttctttgtctatgaa gttacaagcaccaagtatacaagagatgtctttaaggaacttcttgtagcacttgttgct gctattttctcaggaatgggcatgttatttttgatgttatgggtagggatatatgtatga

DBGET integrated database retrieval system