KEGG   Tunicatimonas pelagia: P0M28_04905
Entry
P0M28_04905       CDS       T09207                                 
Symbol
fabG
Name
(GenBank) 3-oxoacyl-[acyl-carrier-protein] reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
tpel  Tunicatimonas pelagia
Pathway
tpel00061  Fatty acid biosynthesis
tpel00780  Biotin metabolism
tpel01100  Metabolic pathways
tpel01110  Biosynthesis of secondary metabolites
tpel01212  Fatty acid metabolism
tpel01240  Biosynthesis of cofactors
Module
tpel_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:tpel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    P0M28_04905 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    P0M28_04905 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    P0M28_04905 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tpel01004]
    P0M28_04905 (fabG)
Enzymes [BR:tpel01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     P0M28_04905 (fabG)
Lipid biosynthesis proteins [BR:tpel01004]
 Fatty acid synthase
  Component type
   P0M28_04905 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR Epimerase
Other DBs
NCBI-ProteinID: WKN44302
LinkDB
Position
complement(1197459..1198205)
AA seq 248 aa
MKLLSGKTALVTGASRGIGYAIAQKFAEQGANVAFTYLSSVEKGETLEKELGEYGIKAKG
YRSDASDFSAAEQLINSVVADLGSLDILINNAGITQDTLLMRMNEEMWDKVIDVNLKSVY
NTVKAALRTFLKQKSGSIINLTSVVGIKGNAGQANYAASKAGIIGFTKSVALELGSRNIR
SNAIAPGFIETEMTDKLDEKTVQSWRDAIPLKRGGSPDDVADCALFLASDMSTYITGQVL
QVDGGMLT
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaaattactatctggaaaaactgctttggttaccggagcatcgcgcggtattggctat
gccattgcccaaaagtttgccgaacagggtgctaatgttgcgtttacgtatctgtcgagt
gtagagaaaggggagaccctagaaaaagagttaggtgaatacggaataaaggcaaaagga
taccgctctgatgcttccgactttagtgctgccgagcaactaatcaatagcgtagttgct
gatcttggctcattagatatactaattaacaacgcgggtattacccaagatacgctgctg
atgcggatgaatgaggaaatgtgggataaggtaattgacgtaaacctgaaatcagtttac
aatacggtaaaagccgcactgcgtacttttctcaagcaaaaaagtggttcaatcatcaat
ctaacctcggtagtgggcataaaaggaaatgccggacaggccaattatgccgcttccaaa
gcaggaattattggtttcaccaaatcggtagcgttggagctgggttcacggaacattcgt
agtaatgccattgctcctggcttcatagaaaccgaaatgaccgataagctagatgaaaag
acagtgcaaagctggcgcgatgccattcctctcaagcgaggtggctcgcctgatgatgtg
gcagattgcgctttatttttggcttcggatatgtcgacgtacattaccggtcaagtgcta
caggtagacggaggaatgctcacctaa

DBGET integrated database retrieval system