Trifolium pratense (red clover): 123899636 Help Entry 123899636         CDS       T08949                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tpra  Trifolium pratense (red clover) Pathway tpra03420   Nucleotide excision repair tpra04120   Ubiquitin mediated proteolysis tpra04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tpra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123899636    04120 Ubiquitin mediated proteolysis     123899636   09124 Replication and repair    03420 Nucleotide excision repair     123899636  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tpra04121]     123899636    03400 DNA repair and recombination proteins [BR:tpra03400]     123899636 Enzymes [BR:tpra01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      123899636 Ubiquitin system [BR:tpra04121]  Ubiquitin ligases (E3)   UBL E3 ligases    123899636   Multi subunit type E3    SCF complex     Ring finger protein      123899636    Cul2 complex      123899636    Cul3 complex      123899636    Cul4 complex      123899636    Cul7 complex      123899636    Cul8 complex      123899636    Cul9 complex      123899636 DNA repair and recombination proteins [BR:tpra03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       123899636     TCR (transcription coupled repair) factors      Cul4-CSA complex       123899636 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 CCG zf-C3HC4_2 zf-RING_11 zf-C3HC4 zf-RING_16 Motif Other DBs NCBI-GeneID:  123899636 NCBI-ProteinID:  XP_045806769 LinkDB All DBs Position LG7:50618851..50622696 Genome browser AA seq 119 aa AA seqDB search MATLDSDVPMVPAGESSCCSHGASSSSKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHI MDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcgacactcgattccgacgttccaatggttcccgccggcgagagctcctgctgctct cacggtgcctcttcttcatccaagaagcctaagcgattcgagatcaagaagtggaatgcc gtttctctttgggcttgggatattgttgttgataattgcgctatctgcaggaatcatatc atggatctctgcattgagtgtcaggcaaaccaggctagtgctaccagcgaggaatgcaca gttgcttggggggtttgtaaccatgcttttcacttccattgcataagtcgatggttgaag actcgtcaagtttgtccactagataacagtgagtgggagtttcagaaatatggtcactag

DBGET integrated database retrieval system