Trifolium pratense (red clover): 123920291 Help Entry 123920291         CDS       T08949                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tpra  Trifolium pratense (red clover) Pathway tpra03420   Nucleotide excision repair tpra04120   Ubiquitin mediated proteolysis tpra04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tpra00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     123920291    04120 Ubiquitin mediated proteolysis     123920291   09124 Replication and repair    03420 Nucleotide excision repair     123920291  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tpra04121]     123920291    03400 DNA repair and recombination proteins [BR:tpra03400]     123920291 Enzymes [BR:tpra01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      123920291 Ubiquitin system [BR:tpra04121]  Ubiquitin ligases (E3)   UBL E3 ligases    123920291   Multi subunit type E3    SCF complex     Ring finger protein      123920291    Cul2 complex      123920291    Cul3 complex      123920291    Cul4 complex      123920291    Cul7 complex      123920291    Cul8 complex      123920291    Cul9 complex      123920291 DNA repair and recombination proteins [BR:tpra03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       123920291     TCR (transcription coupled repair) factors      Cul4-CSA complex       123920291 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  123920291 NCBI-ProteinID:  XP_045828511 LinkDB All DBs Position LG4:complement(13681900..13684955) Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMVPAGEASSSGAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgacacttgattccgacgtgcctatggttcccgccggcgaggcttcaagcagtggc gccggtccatcttccaagaaacccaagcgattcgagatcaagaagtggaacgctgtcgct ctctgggcatgggatatcgttgttgataactgtgctatatgccgaaaccacatcatggat ctctgcatcgagtgccaagctaatcaggctagtgctactagcgaggaatgcactgttgct tggggggtttgtaaccacgcttttcacttccattgcattagcagatggctcaagactcgg caagtttgtcctctagataacagtgagtgggagtttcagaaatatggccactag

DBGET integrated database retrieval system