Trichogramma pretiosum: 106652040 Help Entry 106652040         CDS       T07644                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tpre  Trichogramma pretiosum Pathway tpre03420   Nucleotide excision repair tpre04120   Ubiquitin mediated proteolysis tpre04141   Protein processing in endoplasmic reticulum tpre04310   Wnt signaling pathway tpre04341   Hedgehog signaling pathway - fly tpre04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:tpre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106652040    04120 Ubiquitin mediated proteolysis     106652040   09124 Replication and repair    03420 Nucleotide excision repair     106652040  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     106652040    04341 Hedgehog signaling pathway - fly     106652040    04350 TGF-beta signaling pathway     106652040  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tpre04121]     106652040    03400 DNA repair and recombination proteins [BR:tpre03400]     106652040 Enzymes [BR:tpre01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      106652040 Ubiquitin system [BR:tpre04121]  Ubiquitin ligases (E3)   UBL E3 ligases    106652040   Multi subunit type E3    SCF complex     Ring finger protein      106652040    Cul2 complex      106652040    Cul3 complex      106652040    Cul4 complex      106652040    Cul7 complex      106652040    Cul8 complex      106652040    Cul9 complex      106652040 DNA repair and recombination proteins [BR:tpre03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       106652040     TCR (transcription coupled repair) factors      Cul4-CSA complex       106652040 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  106652040 NCBI-ProteinID:  XP_014226261 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MSAMDVEDEDMDAPSSSNVKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIEC QANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgtcggctatggatgttgaagatgaagatatggatgcgccaagctccagcaacgtcaag ggagaaaaaaagcgttttgaagtcaaaaagtggaatgccgtcgctttatgggcatgggat attgttgttgacaactgtgctatttgccgtaatcacattatggacctctgtatagagtgt caagcaaatcaagcatcagctactagcgaagagtgtactgttgcctggggtgtttgtaat catgcttttcacttccattgcatctcccgttggttaaagactagacaagtgtgtccactg gataatcgtgaatgggaattccaaaaatacggccattaa

DBGET integrated database retrieval system