Thalassiosira pseudonana: THAPSDRAFT_40817 Help Entry THAPSDRAFT_40817  CDS       T01078                                  Name (RefSeq) predicted protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tps  Thalassiosira pseudonana Pathway tps03420   Nucleotide excision repair tps04120   Ubiquitin mediated proteolysis tps04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tps00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     THAPSDRAFT_40817    04120 Ubiquitin mediated proteolysis     THAPSDRAFT_40817   09124 Replication and repair    03420 Nucleotide excision repair     THAPSDRAFT_40817  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tps04121]     THAPSDRAFT_40817    03400 DNA repair and recombination proteins [BR:tps03400]     THAPSDRAFT_40817 Enzymes [BR:tps01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      THAPSDRAFT_40817 Ubiquitin system [BR:tps04121]  Ubiquitin ligases (E3)   UBL E3 ligases    THAPSDRAFT_40817   Multi subunit type E3    SCF complex     Ring finger protein      THAPSDRAFT_40817    Cul2 complex      THAPSDRAFT_40817    Cul3 complex      THAPSDRAFT_40817    Cul4 complex      THAPSDRAFT_40817    Cul7 complex      THAPSDRAFT_40817    Cul8 complex      THAPSDRAFT_40817    Cul9 complex      THAPSDRAFT_40817 DNA repair and recombination proteins [BR:tps03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       THAPSDRAFT_40817     TCR (transcription coupled repair) factors      Cul4-CSA complex       THAPSDRAFT_40817 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_5 zf-C3HC4_3 zf-RING_16 zf-RING_11 zinc_ribbon_16 zf-Nse zf-RING-like Prok-RING_4 zf-RING_4 zf-C3H2C3 PHD_NSD zf-C3HC4_4 Rtf2 TerY_C zf-RING_Vps41 Baculo_RING zf_RING_Vps8 zf_RING_Vps8_fungal Zf_2nd_IFT121 Motif Other DBs NCBI-GeneID:  7448201 NCBI-ProteinID:  XP_002290820 JGI:  40817 UniProt:  B8C3J2 LinkDB All DBs Position 5:complement(1756815..1757638) Genome browser AA seq 122 aa AA seqDB search MADAPPAADTASEDKKKSPSRPTTAPRFEIKKWNAVAMWSWDICADTCAICRNSLNEPSI EYQANPSPTNDNGLSIAFGNCGHVFHLDCIQRWLRTRSVCPLCNKEWDFAKIERIPGYGI GM NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggccgatgccccacccgccgctgatacagcctccgaagataaaaagaagtcaccttcc agacccacaactgcacctcgctttgagatcaagaaatggaatgccgtagccatgtggtca tgggacatttgcgccgacacctgcgccatctgccgcaactccctcaacgaaccctccatc gaatatcaggccaacccgtccccaacgaatgataacgggttgagcatcgcttttggaaat tgcggtcacgtgtttcatttggattgtatccaaaggtggttgaggacgaggagtgtttgt cctctttgtaataaggagtgggattttgcaaagattgagaggattccggggtatgggatt ggaatgtag

DBGET integrated database retrieval system