Trichomycterus rosablanca: 134301032 Help Entry 134301032         CDS       T09921                                  Symbol bcl2a Name (RefSeq) apoptosis regulator Bcl-2a   KO K02161   apoptosis regulator Bcl-2 Organism trn  Trichomycterus rosablanca Pathway trn04115   p53 signaling pathway trn04140   Autophagy - animal trn04141   Protein processing in endoplasmic reticulum trn04210   Apoptosis trn04217   Necroptosis trn04261   Adrenergic signaling in cardiomyocytes trn04340   Hedgehog signaling pathway trn04510   Focal adhesion trn04621   NOD-like receptor signaling pathway trn05132   Salmonella infection trn05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:trn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     134301032 (bcl2a)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     134301032 (bcl2a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134301032 (bcl2a)   09143 Cell growth and death    04210 Apoptosis     134301032 (bcl2a)    04217 Necroptosis     134301032 (bcl2a)    04115 p53 signaling pathway     134301032 (bcl2a)   09144 Cellular community - eukaryotes    04510 Focal adhesion     134301032 (bcl2a)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     134301032 (bcl2a)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     134301032 (bcl2a)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     134301032 (bcl2a)   09171 Infectious disease: bacterial    05132 Salmonella infection     134301032 (bcl2a)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:trn01009]     134301032 (bcl2a) Protein phosphatases and associated proteins [BR:trn01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      134301032 (bcl2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 M11L Motif Other DBs NCBI-GeneID:  134301032 NCBI-ProteinID:  XP_062841622 LinkDB All DBs Position 23:complement(7422358..7509756) Genome browser AA seq 188 aa AA seqDB search MARPYDNRDIVEKYIYHKLLKRGYVWEFGAGFEEVEVLERRLHRVLREAGDEIERTYQRD FAAMSDQLQFTASNAQRRFTAVIEELFRDGVNWGRIVVFFEFGGTLCVDSVNREMAAQVD NIARWMTDYLNGPLQNWIRDNGGWDAFVELYSQRRASAFHPWPYLKTVFGLAALGAAGVT IGALFSQK NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atggcacgtccgtatgacaatcgggacatcgtggaaaagtatatctatcacaaactttta aagcgcggatacgtgtgggagttcggcgctggattcgaggaggtggaagttctggagcgc aggctgcaccgcgtgctgcgcgaggctggagatgagatcgagaggacctaccagcgcgac tttgcggccatgtcggatcaactgcagttcacagccagcaatgcgcagcgccgattcaca gctgtcatcgaggagctgttccgggacggagtcaactggggacgcatcgttgtctttttc gagttcggaggaaccctatgtgtggacagcgtgaaccgggagatggcggctcaggtggac aacatagcccggtggatgacggattacctgaacgggccgttgcagaactggattcgggac aatggcggctgggatgcttttgtggagctttacagtcagcggagagcctctgcgttccac ccttggccttatctaaagacagtgtttggtctggcagcactaggggcagcaggagtcacc attggagcccttttctctcaaaagtga

DBGET integrated database retrieval system