Triplophysa rosa: 130553901 Help Entry 130553901         CDS       T09216                                  Symbol bcl2b Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism tros  Triplophysa rosa Pathway tros04115   p53 signaling pathway tros04140   Autophagy - animal tros04141   Protein processing in endoplasmic reticulum tros04210   Apoptosis tros04217   Necroptosis tros04261   Adrenergic signaling in cardiomyocytes tros04340   Hedgehog signaling pathway tros04510   Focal adhesion tros04621   NOD-like receptor signaling pathway tros05132   Salmonella infection tros05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:tros00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130553901 (bcl2b)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     130553901 (bcl2b)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130553901 (bcl2b)   09143 Cell growth and death    04210 Apoptosis     130553901 (bcl2b)    04217 Necroptosis     130553901 (bcl2b)    04115 p53 signaling pathway     130553901 (bcl2b)   09144 Cellular community - eukaryotes    04510 Focal adhesion     130553901 (bcl2b)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     130553901 (bcl2b)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     130553901 (bcl2b)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     130553901 (bcl2b)   09171 Infectious disease: bacterial    05132 Salmonella infection     130553901 (bcl2b)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tros01009]     130553901 (bcl2b) Protein phosphatases and associated proteins [BR:tros01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      130553901 (bcl2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  130553901 NCBI-ProteinID:  XP_057189115 LinkDB All DBs Position LG5:16667689..16703437 Genome browser AA seq 207 aa AA seqDB search MAQESVFDSRNIVVKYIRHKLWKKGYVWEVNGHDDSVSNGLMMGIQQDSGVSPSPIHIAL HKVLRDAGDELERLYQSDFAEMSKQLHLTSITAHQRFTAVIDELFRDGVNWGRILAFFEF GGTVCVECVNKEMTAQVDNIAGWMTEYLNGPLHGWIQENGGWEAFVELYGRQRDSVFRSS WSSIVTVFGLAALGAVGFTIGAYLAQK NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcacaagagagtgtcttcgacagccgcaatatagtggttaagtatatccgtcataag ctatggaagaagggatacgtgtgggaagtgaacggacatgatgatagtgtttctaatgga ctgatgatggggatacaacaggacagcggcgtttctcccagccctattcacatagctctc cataaggtgttacgggacgccggggatgaactggagcggttatatcagtcggactttgcg gagatgtccaagcagctgcatctcacgtccatcacggcgcaccagcgcttcaccgcagtc atagatgagttgttcagggacggggtgaactggggcagaattctcgcttttttcgaattt ggaggcaccgtttgcgttgagtgcgtgaataaggagatgacggcgcaggtggataacatc gcgggctggatgacggaatacctgaacggaccgctgcacggctggatccaagagaacggc ggctgggaggcgtttgtggagctgtatggccgacagagggactctgtgttccgcagttcc tggtcatcaatagtgacggtcttcggtctggctgctctcggggccgttggcttcaccata ggggcctaccttgcacagaaatga

DBGET integrated database retrieval system