Takifugu rubripes (torafugu): 101067055 Help Entry 101067055         CDS       T02386                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism tru  Takifugu rubripes (torafugu) Pathway tru03030   DNA replication tru03410   Base excision repair tru03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tru00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101067055 (pole4)    03410 Base excision repair     101067055 (pole4)    03420 Nucleotide excision repair     101067055 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tru03032]     101067055 (pole4)    03400 DNA repair and recombination proteins [BR:tru03400]     101067055 (pole4) Enzymes [BR:tru01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      101067055 (pole4) DNA replication proteins [BR:tru03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     101067055 (pole4) DNA repair and recombination proteins [BR:tru03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       101067055 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  101067055 NCBI-ProteinID:  XP_003974196 Ensembl:  ENSTRUG00000000810 UniProt:  H2RP88 LinkDB All DBs Position 20:complement(8643807..8645739) Genome browser AA seq 130 aa AA seqDB search MATTLVTSVNPTELDTNRSGSEDENRGAETEEESGQQPHTGPAATASHSRLSKLPLARIK ALMKTDPDVSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAID EFAFLEGTLD NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atggcgacaacattggtgacatcggttaaccccacggagctcgatactaaccggagtggg agcgaggatgagaaccgcggggccgagacggaggaggagagcggtcagcagccgcacaca ggccccgcagccaccgcatcacacagccgtctgtcaaaactcccgctggcccgcatcaag gcgctgatgaagacagatccagacgtgtcacttgccagccaggaatccgtgttcattatc gcaaaagctacggaattatttgttgaaatgattgccaaagatgccctggtttatgctcag caagggaagaggaaaactttgcagaggaaagatttagacaacgcaatagaggccatagat gaatttgcatttctcgaagggacactagattaa

DBGET integrated database retrieval system