Takifugu rubripes (torafugu): 101079814 Help Entry 101079814         CDS       T02386                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tru  Takifugu rubripes (torafugu) Pathway tru03420   Nucleotide excision repair tru04110   Cell cycle tru04114   Oocyte meiosis tru04120   Ubiquitin mediated proteolysis tru04141   Protein processing in endoplasmic reticulum tru04310   Wnt signaling pathway tru04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:tru00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101079814    04120 Ubiquitin mediated proteolysis     101079814   09124 Replication and repair    03420 Nucleotide excision repair     101079814  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     101079814    04350 TGF-beta signaling pathway     101079814  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     101079814    04114 Oocyte meiosis     101079814  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tru04121]     101079814    03400 DNA repair and recombination proteins [BR:tru03400]     101079814 Enzymes [BR:tru01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      101079814 Ubiquitin system [BR:tru04121]  Ubiquitin ligases (E3)   UBL E3 ligases    101079814   Multi subunit type E3    SCF complex     Ring finger protein      101079814    Cul2 complex      101079814    Cul3 complex      101079814    Cul4 complex      101079814    Cul7 complex      101079814    Cul8 complex      101079814    Cul9 complex      101079814 DNA repair and recombination proteins [BR:tru03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       101079814     TCR (transcription coupled repair) factors      Cul4-CSA complex       101079814 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  101079814 NCBI-ProteinID:  XP_029688074 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MAAAMDVDSPANSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQAS ATSEECTVAWGVCNHAFHFHCISRWLKARQVCPLDNREWEYQKYGH NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctgctgctatggacgtggattcaccagcaaacagtggagccagcaagaagcggttt gaagtgaagaagtggaacgccgtcgcgctgtgggcctgggacattgtggtggataactgt gcaatctgtaggaaccacattatggatctctgtatagaatgccaggccaaccaggcttct gccacgtctgaggagtgcaccgtggcctggggcgtgtgcaatcatgctttccacttccac tgcatctctcgctggttgaaagccagacaggtgtgcccgctggacaacagggagtgggaa tatcagaaatatggacattag

DBGET integrated database retrieval system