Takifugu rubripes (torafugu): 115249889 Help Entry 115249889         CDS       T02386                                  Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tru  Takifugu rubripes (torafugu) Pathway tru03420   Nucleotide excision repair tru04110   Cell cycle tru04114   Oocyte meiosis tru04120   Ubiquitin mediated proteolysis tru04141   Protein processing in endoplasmic reticulum tru04310   Wnt signaling pathway tru04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:tru00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115249889    04120 Ubiquitin mediated proteolysis     115249889   09124 Replication and repair    03420 Nucleotide excision repair     115249889  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     115249889    04350 TGF-beta signaling pathway     115249889  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     115249889    04114 Oocyte meiosis     115249889  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tru04121]     115249889    03400 DNA repair and recombination proteins [BR:tru03400]     115249889 Enzymes [BR:tru01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      115249889 Ubiquitin system [BR:tru04121]  Ubiquitin ligases (E3)   UBL E3 ligases    115249889   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      115249889    Cul2 complex      115249889    Cul3 complex      115249889    Cul4 complex      115249889    Cul7 complex      115249889    Cul8 complex      115249889    Cul9 complex      115249889 DNA repair and recombination proteins [BR:tru03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       115249889     TCR (transcription coupled repair) factors      Cul4-CSA complex       115249889 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  115249889 NCBI-ProteinID:  XP_029692292 LinkDB All DBs Position 5:4236777..4238941 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPTGANSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctgccgcgatggacgttgacacaccgactggcgcaaacagtggagccagcaaaaag cgttttgaagttaaaaagtggaacgccgtcgcgctgtgggcctgggacattgtggtggat aactgtgcaatctgtaggaaccacattatggatctctgtatagaatgccaggccaaccag gcttctgccacgtctgaggagtgcaccgtggcctggggcgtgtgcaatcatgctttccac ttccactgcatctctcgctggttgaaaaccagacaggtgtgcccgctggacaacagggag tgggaatttcagaaatatggacattag

DBGET integrated database retrieval system