KEGG   Terriglobus saanensis: AciPR4_0264
Entry
AciPR4_0264       CDS       T01408                                 
Name
(GenBank) DNA ligase, NAD-dependent
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
tsa  Terriglobus saanensis
Pathway
tsa03030  DNA replication
tsa03410  Base excision repair
tsa03420  Nucleotide excision repair
tsa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AciPR4_0264
   03410 Base excision repair
    AciPR4_0264
   03420 Nucleotide excision repair
    AciPR4_0264
   03430 Mismatch repair
    AciPR4_0264
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tsa03032]
    AciPR4_0264
   03400 DNA repair and recombination proteins [BR:tsa03400]
    AciPR4_0264
Enzymes [BR:tsa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     AciPR4_0264
DNA replication proteins [BR:tsa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     AciPR4_0264
DNA repair and recombination proteins [BR:tsa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     AciPR4_0264
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     AciPR4_0264
   MMR (mismatch excision repair)
    DNA ligase
     AciPR4_0264
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AciPR4_0264
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 DNA_ligase_ZBD PTCB-BRCT Nlig-Ia HHH 5_3_exonuc BRCT_2 RNA_ligase HHH_3 Zn_ribbon_NUD Auto_anti-p27
Other DBs
NCBI-ProteinID: ADV81102
UniProt: E8V0N9
LinkDB
Position
complement(310169..312253)
AA seq 694 aa
MSPEQRASELRAEIEHHEHAYYVLDKPEISDAQYDALVNLLKALETEHPELVTPESPTQR
VGGKPREGFAKVAHSRPMLSLDNAYNEAELRAWAERVTTSLPASDAVEYTCEYKLDGLSL
ALHYENGQLVRGVTRGDGSVGEDVTSNVRTIRSVPLRIAAAKLKAAGLPGTFEVRGEVVM
PQSAFEELNRQREAAGQAAAANPRNAAAGTIRTIEPSIVAQRRLDFYAYFLLRDGDTLLK
SQQATLDALRATGFRVNAQARTVGTIDEVLGFIAQAEAERDGLGYEIDGVVIKVNATALQ
KRLGFTGKAPRWAIAYKFPARAGVTQLRGVIFQVGRTGKLTPVADLQPIFIGGTTVTRAT
LHNADEIERLGLKIGDHVSVERGGDVIPKITHVVEDKIHARGTEEIVFPTVCPRCGEPVV
REEGEVDWRCVNASCPARLEEELRHFASRGVMNIEGLGESLVAQLLGHTVAEAVDATAGV
GEGEESVAEAPTREALVHSVADIYGLTLEQLMGLERIGQKSAESLLAEIEKSKSAPLSRV
LLGLGIRHVGERTAQTLAEEFGSMDALISATEEDLTRVNDVGPKVAEAIREWFANEKNLL
LVQRLKDAGLTMTAEKRERGTQLAGMTFVLTGTLPTLTRDTAKEKIEAAGGKVSGSVSKK
TTYVVAGEDAGSKLEKARELGIAVLDEAGLLEML
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgtcccccgaacaaagagcctccgaactgcgcgccgagattgagcatcacgaacacgct
tactatgtcctggataagcctgagatctccgacgcgcagtacgacgcgctggtgaatctt
ttgaaggcgttggagaccgaacatccggagctggtgacgccggagtctccgacgcagcgt
gtcggcggaaagccgcgcgagggatttgcgaaggtcgctcactcgcgaccgatgctctcc
ctggacaatgcgtacaacgaagccgagctgcgagcgtgggcggagcgcgtgaccacttcc
cttcccgcttcggacgcggtggagtacacctgcgagtacaagctggatgggctgtcgctt
gccctgcactatgagaacggccagctggtgcgcggcgtgacgcggggcgatggcagcgtg
ggcgaagacgtcacgagcaacgtgcgcacgatccgctctgtgccgttgcgcatcgctgct
gcaaagttgaaggccgcgggattgccaggcacgttcgaggtgcgtggtgaagtggtcatg
ccgcagtctgcctttgaagaactcaaccggcagcgcgaggctgcgggacaggcggcggcg
gcgaatccgcgcaatgcggcggcgggaacgatacgaaccattgagccaagtatcgtggcg
caacggcgtctggacttctacgcgtactttctcctgcgcgatggcgacacgctgctgaaa
tcgcaacaggcgacactcgatgctctgcgcgctacgggatttcgcgtgaatgcgcaggcg
aggacggtaggaacaattgacgaagtgctgggctttatcgcgcaggcagaggccgagcgt
gacggcctgggatacgagatcgacggcgttgtgatcaaggtgaatgctacagcgctgcaa
aaacggctcgggttcacgggcaaggctccgcgatgggcgattgcctacaagttccctgcg
cgtgcgggtgtgacccagttgcgcggtgtgatcttccaagtaggaaggacgggcaagctg
acgcctgttgccgatctgcaaccgatctttatcggcggaacgacggtaacgcgcgcgacg
ctgcacaacgcggacgaaatcgagcggctgggtttgaagatcggcgatcacgtctccgtt
gaacgtggcggcgacgtgattccgaagatcacgcatgtcgtcgaagacaagatacacgca
cgcggaacagaggagattgtttttccgacggtgtgtccgcgatgcggcgagccggtggtg
cgtgaagaaggagaagtcgactggcgctgcgtgaatgccagttgccccgcgcggttggag
gaagagctgcggcactttgcttcgcgcggcgtgatgaacattgaaggcctgggcgaatcg
ctagtagcccagcttctgggacatacagttgccgaagcggttgacgccacagcgggagtg
ggggaaggcgaagagtccgtggccgaggcgccgacgcgcgaggcgctggtacattctgtc
gcggacatctatggactcacgctggagcagctgatggggcttgagcgcattgggcagaag
agcgccgagtctcttctggcggagattgaaaagtccaagtcggccccgctctcccgcgtg
ctgctgggcctgggcattcgtcatgtaggcgagcgcaccgcacagacgctggccgaagaa
ttcggcagcatggacgctctgatctccgcgacggaagaagacctgacccgtgtgaacgat
gttgggccgaaggtagctgaggcgatccgcgagtggtttgcgaacgagaaaaatcttctg
ctggtccagcgattgaaagacgccggtctgacgatgacggcggagaagcgcgagcgcgga
acgcagcttgccggcatgacgtttgtactgacaggcacgctacccacgttgacccgcgac
acggccaaggagaagattgaggcggcgggtggaaaggtctccggctctgtgagcaagaag
acgacctacgtggttgcgggcgaagatgcgggaagcaagctggagaaggcgcgtgagctt
ggcatagcggtgctggatgaggccgggcttctggagatgctgtag

DBGET integrated database retrieval system