Trachymyrmex septentrionalis: 108752494 Help Entry 108752494         CDS       T11226                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tsep  Trachymyrmex septentrionalis Pathway tsep03420   Nucleotide excision repair tsep04120   Ubiquitin mediated proteolysis tsep04141   Protein processing in endoplasmic reticulum tsep04310   Wnt signaling pathway tsep04341   Hedgehog signaling pathway - fly tsep04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:tsep00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108752494    04120 Ubiquitin mediated proteolysis     108752494   09124 Replication and repair    03420 Nucleotide excision repair     108752494  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108752494    04341 Hedgehog signaling pathway - fly     108752494    04350 TGF-beta signaling pathway     108752494  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tsep04121]     108752494    03400 DNA repair and recombination proteins [BR:tsep03400]     108752494 Enzymes [BR:tsep01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108752494 Ubiquitin system [BR:tsep04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108752494   Multi subunit type E3    SCF complex     Ring finger protein      108752494    Cul2 complex      108752494    Cul3 complex      108752494    Cul4 complex      108752494    Cul7 complex      108752494    Cul8 complex      108752494    Cul9 complex      108752494 DNA repair and recombination proteins [BR:tsep03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108752494     TCR (transcription coupled repair) factors      Cul4-CSA complex       108752494 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  108752494 NCBI-ProteinID:  XP_018348842 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MATTMEIDDDECDLPTSSSGKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcgacaaccatggagatagacgatgatgagtgtgatctaccgacctccagtagtgga aaaggcgaaaagaagcgttttgaagtgaaaaagtggaacgcagtggcattatgggcctgg gatattgttgtggataattgcgctatttgccgtaatcatattatggacctgtgtatcgaa tgtcaagcaaaccaggcctctgcgactagcgaggagtgcacggtagcctggggtgtatgt aatcacgcctttcattttcattgtatttcacgttggctaaaaacacgacaagtctgtcca cttgataatcgcgaatgggagtttcagaaatatggccattaa

DBGET integrated database retrieval system