Thermus thermophilus HB27: TT_C1503
Help
Entry
TT_C1503 CDS
T00170
Symbol
ubiE
Name
(GenBank) ubiquinone/menaquinone biosynthesis methyltransferase ubiE
KO
K03183
demethylmenaquinone methyltransferase / 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase [EC:
2.1.1.163
2.1.1.201
]
Organism
tth
Thermus thermophilus HB27
Pathway
tth00130
Ubiquinone and other terpenoid-quinone biosynthesis
tth01100
Metabolic pathways
tth01110
Biosynthesis of secondary metabolites
tth01240
Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:
tth00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00130 Ubiquinone and other terpenoid-quinone biosynthesis
TT_C1503 (ubiE)
Enzymes [BR:
tth01000
]
2. Transferases
2.1 Transferring one-carbon groups
2.1.1 Methyltransferases
2.1.1.163 demethylmenaquinone methyltransferase
TT_C1503 (ubiE)
2.1.1.201 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase
TT_C1503 (ubiE)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ubie_methyltran
Methyltransf_25
Methyltransf_11
Methyltransf_31
Methyltransf_12
Methyltransf_23
MTS
MetW
Methyltransf_2
UPF0020
Anamorsin_N
Methyltransf_4
NpmA
PCMT
Motif
Other DBs
NCBI-ProteinID:
AAS81845
UniProt:
Q72HI4
LinkDB
All DBs
Position
complement(1428254..1428916)
Genome browser
AA seq
220 aa
AA seq
DB search
MFSEIAPRYDLLNRLLSFGADLRWRRRAVDLALEKAPKRILDLATGTGDLALMLKERAPG
AEVVGADFAPPMLAIARRKAEARGLEVRFLEADALALPFPDGAFDAVTIAFGFRNFADYE
KALGELYRVLAPGGRLVVLEFPPPPKGAFGLVYRVYFQRVLPFLGGLISGNFGAYRYLPE
SVEAFPAPEALKAMMAAAGFSVRYELLTFGVAAIHVGDRP
NT seq
663 nt
NT seq
+upstream
nt +downstream
nt
atgttctcggagatcgccccccgctacgacctcctgaaccgcctcctctccttcggggcg
gacctccgctggcgcaggcgggcggtggacctggccctggagaaggccccaaagcgcatc
ctggacctggccacggggacgggggacctggccctcatgctcaaggaaagggcccccggg
gcggaggtggtgggggcggacttcgccccgcccatgctggcgatcgcccgcaggaaggcg
gaggcgaggggcctcgaggtccgcttcctcgaggcggacgccctcgccctcccctttccc
gacggggcctttgacgccgtcaccatcgccttcggcttccgcaacttcgccgattacgaa
aaggccctaggggagctttaccgggtcctggcccccggggggaggctcgtggttctggag
tttcccccgccccctaagggggcctttggcctcgtctaccgggtctacttccagcgggtc
ctccctttcctcggggggcttatttcggggaacttcggggcctaccgctaccttccggaa
agcgtggaggccttccccgctcctgaggccctgaaggccatgatggcggcggcggggttt
tccgtgcgctacgagctcctcaccttcggggtggcggccatccacgtgggggacaggccc
taa
DBGET
integrated database retrieval system