Thermus thermophilus HB27: TT_C1796 Help Entry TT_C1796          CDS       T00170                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism tth  Thermus thermophilus HB27 Pathway tth00790   Folate biosynthesis tth01100   Metabolic pathways tth01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:tth00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     TT_C1796 Enzymes [BR:tth01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      TT_C1796  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      TT_C1796  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      TT_C1796 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AAS82138 UniProt:  Q72GQ2 LinkDB All DBs Position 1703252..1703608 Genome browser AA seq 118 aa AA seqDB search MGEIALLGLEFYGRHGVMPEEGRLGARFVVDLWLSVPFEGKGDRLEETVDYAAVYALVEE AVRHRRFYLIEALADHLAEELLKAFPRLQAVRVRVHKPHAPIPGVFRDVYAETQKSRS NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgggggagatcgcccttctcgggcttgagttctacgggcgccacggggtcatgcccgag gaggggcggcttggggcccggttcgtggtggacctctggctttccgtgccctttgagggc aagggggacaggctggaggagaccgtggactacgccgccgtctacgccctggtggaggag gcggtgcgccaccgccgcttctacctcattgaggccctggcggaccatttggcggaggag cttttgaaggcctttccccgcctccaggcggtccgggtccgggtccacaagccccacgcc cccatccccggggtttttcgggacgtctacgccgaaacgcaaaaatcccgttcctaa

DBGET integrated database retrieval system