KEGG   Thermus thermophilus HB8: TTHA1880
Entry
TTHA1880          CDS       T00220                                 
Symbol
TTHA1880
Name
(GenBank) MutT/nudix family protein
  KO
K18445  diadenosine hexaphosphate hydrolase (ATP-forming) [EC:3.6.1.61]
Organism
ttj  Thermus thermophilus HB8
Pathway
ttj00230  Purine metabolism
ttj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    TTHA1880 (TTHA1880)
Enzymes [BR:ttj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.61  diadenosine hexaphosphate hydrolase (ATP-forming)
     TTHA1880 (TTHA1880)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-ProteinID: BAD71703
UniProt: Q5SH50
LinkDB
Position
1:complement(1765410..1765790)
AA seq 126 aa
MELGAGGVVFNAKREVLLLRDRMGFWVFPKGHPEPGESLEEAAVREVWEETGVRAEVLLP
LYPTRYVNPKGVEREVHWFLMRGEGAPRLEEGMTGAGWFSPEEARALLAFPEDLGLLEVA
LERLPL
NT seq 381 nt   +upstreamnt  +downstreamnt
atggagctaggggccgggggcgtggtcttcaacgccaaacgggaggtcctcctccttcgc
gaccgcatgggcttctgggtcttccccaagggccacccggagccgggggagagcctggag
gaggcggcggtgcgggaggtctgggaggagacgggggtccgggccgaggtcctccttccc
ctctaccccacccgctacgtcaaccccaagggggtagagcgggaggtgcactggttcctc
atgcggggggagggggcgccccgcctggaggagggcatgaccggggcggggtggttttcc
cccgaggaggcccgcgccctcctcgccttccccgaggacctggggcttttggaggtggcc
cttgagcgtctaccgctttga

DBGET integrated database retrieval system