Tupaia chinensis (Chinese tree shrew): 102474007 Help Entry 102474007         CDS       T02978                                  Name (RefSeq) protein deglycase DJ-1-like   KO K05687   protein DJ-1 [EC:3.5.1.124] Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup05012   Parkinson disease tup05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:tup00001]  09160 Human Diseases   09164 Neurodegenerative disease    05012 Parkinson disease     102474007    05022 Pathways of neurodegeneration - multiple diseases     102474007  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:tup01002]     102474007   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102474007 Enzymes [BR:tup01000]  3. Hydrolases   3.5  Acting on carbon-nitrogen bonds, other than peptide bonds    3.5.1  In linear amides     3.5.1.124  protein deglycase      102474007 Peptidases and inhibitors [BR:tup01002]  Cysteine peptidases   Family C56: PfpI endopeptidase family    102474007 Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102474007 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DJ-1_PfpI GATase_3 Motif Other DBs NCBI-GeneID:  102474007 NCBI-ProteinID:  XP_014442596 LinkDB All DBs Position Un AA seq 155 aa AA seqDB search MLRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLLKYKKEGPYDMVVLPRDNLGAQNLSE SAAMKEILKEQEKRKGLIAAICAGPTALLAHEIDFGSKVKTHPLAKDKTMNGSHYSYSEN RVEKDGLILTRHGPGTSFEFALAIVEALSGKEVAD NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgctgagacgagctgggattaaggtcactgttgctggcctggctggaaaagacccggtg cagtgtagtcgtgatgttgtcatttgtcctgatgccagtcttttaaaatacaaaaaagag ggaccttatgacatggtggttctaccacgagataatctgggtgcacagaatttatccgag tctgctgccatgaaagagatcctgaaggagcaggaaaagcggaagggccttatagccgcc atctgtgcaggtcctactgccctgttggctcatgaaatagactttggaagcaaagttaaa acacacccacttgctaaagacaaaacgatgaatggaagtcattacagctactctgagaat cgtgtggaaaaggatggtctgattcttacacgccatggtcctgggaccagcttcgaattt gctctcgcaattgttgaggcactgagcggcaaggaggtggccgactaa

DBGET integrated database retrieval system