Tupaia chinensis (Chinese tree shrew): 102474592 Help Entry 102474592         CDS       T02978                                  Symbol BCL2 Name (RefSeq) BCL2, apoptosis regulator   KO K02161   apoptosis regulator Bcl-2 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup01521   EGFR tyrosine kinase inhibitor resistance tup01522   Endocrine resistance tup01524   Platinum drug resistance tup04064   NF-kappa B signaling pathway tup04066   HIF-1 signaling pathway tup04071   Sphingolipid signaling pathway tup04115   p53 signaling pathway tup04140   Autophagy - animal tup04141   Protein processing in endoplasmic reticulum tup04151   PI3K-Akt signaling pathway tup04210   Apoptosis tup04215   Apoptosis - multiple species tup04217   Necroptosis tup04261   Adrenergic signaling in cardiomyocytes tup04340   Hedgehog signaling pathway tup04510   Focal adhesion tup04621   NOD-like receptor signaling pathway tup04630   JAK-STAT signaling pathway tup04722   Neurotrophin signaling pathway tup04725   Cholinergic synapse tup04915   Estrogen signaling pathway tup04928   Parathyroid hormone synthesis, secretion and action tup04933   AGE-RAGE signaling pathway in diabetic complications tup05014   Amyotrophic lateral sclerosis tup05022   Pathways of neurodegeneration - multiple diseases tup05132   Salmonella infection tup05145   Toxoplasmosis tup05152   Tuberculosis tup05161   Hepatitis B tup05162   Measles tup05168   Herpes simplex virus 1 infection tup05169   Epstein-Barr virus infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer tup05206   MicroRNAs in cancer tup05207   Chemical carcinogenesis - receptor activation tup05210   Colorectal cancer tup05215   Prostate cancer tup05222   Small cell lung cancer tup05226   Gastric cancer tup05417   Lipid and atherosclerosis tup05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102474592 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     102474592 (BCL2)    04630 JAK-STAT signaling pathway     102474592 (BCL2)    04064 NF-kappa B signaling pathway     102474592 (BCL2)    04066 HIF-1 signaling pathway     102474592 (BCL2)    04071 Sphingolipid signaling pathway     102474592 (BCL2)    04151 PI3K-Akt signaling pathway     102474592 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102474592 (BCL2)   09143 Cell growth and death    04210 Apoptosis     102474592 (BCL2)    04215 Apoptosis - multiple species     102474592 (BCL2)    04217 Necroptosis     102474592 (BCL2)    04115 p53 signaling pathway     102474592 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102474592 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102474592 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     102474592 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     102474592 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102474592 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     102474592 (BCL2)    04722 Neurotrophin signaling pathway     102474592 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102474592 (BCL2)    05206 MicroRNAs in cancer     102474592 (BCL2)    05207 Chemical carcinogenesis - receptor activation     102474592 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     102474592 (BCL2)    05226 Gastric cancer     102474592 (BCL2)    05215 Prostate cancer     102474592 (BCL2)    05222 Small cell lung cancer     102474592 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102474592 (BCL2)    05161 Hepatitis B     102474592 (BCL2)    05162 Measles     102474592 (BCL2)    05168 Herpes simplex virus 1 infection     102474592 (BCL2)    05169 Epstein-Barr virus infection     102474592 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     102474592 (BCL2)    05152 Tuberculosis     102474592 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102474592 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102474592 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     102474592 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102474592 (BCL2)    05418 Fluid shear stress and atherosclerosis     102474592 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102474592 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102474592 (BCL2)    01524 Platinum drug resistance     102474592 (BCL2)    01522 Endocrine resistance     102474592 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tup01009]     102474592 (BCL2) Protein phosphatases and associated proteins [BR:tup01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102474592 (BCL2) SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  102474592 NCBI-ProteinID:  XP_006141898 LinkDB All DBs Position Un AA seq 238 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLAQRGYEWDAGDAGAASPGAAPAPGIFSSQPGRTPPPA TPGDPAARTSPSPPPMAAAVAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHL TPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYL NRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK NT seq 717 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgccgggagaacagggtatgataaccgggagatagtgatgaagtacatccac tataagctggcgcagaggggctacgaatgggacgcgggggacgcgggcgctgcgtccccg ggggccgcccccgcgccgggcatcttctcctcccaacccgggcgcacgcccccgcccgcc acgcctggggacccggcagccaggacctcgccgtcgccgcccccgatggccgccgccgtc gcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggccggc gatgacttctcccggcgctaccgccgcgacttcgccgagatgtccagccagctgcacctg acgcccttcaccgcgaggggacgctttgccacggtggtggaggagctcttcagggatggg gtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagc gtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctg aaccggcacctgcacacctggatccaggataacggaggctgggatgctttcgtggaacta tatggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagacgctgctc agtcttgccctggtgggagcctgcatcaccctgggtgcctacctgggccacaagtga

DBGET integrated database retrieval system