Tupaia chinensis (Chinese tree shrew): 102476150 Help Entry 102476150         CDS       T02978                                  Symbol NPPA Name (RefSeq) natriuretic peptide A   KO K12334   natriuretic peptide A Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04022   cGMP-PKG signaling pathway tup04024   cAMP signaling pathway tup04066   HIF-1 signaling pathway tup04081   Hormone signaling tup04270   Vascular smooth muscle contraction tup04714   Thermogenesis tup04921   Oxytocin signaling pathway tup04923   Regulation of lipolysis in adipocytes tup04924   Renin secretion tup04925   Aldosterone synthesis and secretion tup05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     102476150 (NPPA)    04024 cAMP signaling pathway     102476150 (NPPA)    04022 cGMP-PKG signaling pathway     102476150 (NPPA)   09133 Signaling molecules and interaction    04081 Hormone signaling     102476150 (NPPA)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     102476150 (NPPA)    04921 Oxytocin signaling pathway     102476150 (NPPA)    04924 Renin secretion     102476150 (NPPA)    04925 Aldosterone synthesis and secretion     102476150 (NPPA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102476150 (NPPA)   09159 Environmental adaptation    04714 Thermogenesis     102476150 (NPPA)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     102476150 (NPPA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102476150 (NPPA) Cytokines and neuropeptides [BR:tup04052]  Neuropeptides   Unclassified    102476150 (NPPA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP FMN_red Motif Other DBs NCBI-GeneID:  102476150 NCBI-ProteinID:  XP_006145371 LinkDB All DBs Position Un AA seq 155 aa AA seqDB search MGSFPFTTSLLLFLVFLLPGQMGHIGASPVYNGMSSADLMDFKDLLDRLEDKMPLEDEVA PPQILSEQTDEAGAALSPLPEVPPWTGEVSPAQRDGGALGRSPWDSSERSALLKSKLRAM LAAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgggctccttccccttcaccacgagcctcctcctcttcctggtgtttctgcttccaggt caaatgggtcacattggagctagccctgtgtacaatggcatgtccagtgcagacctgatg gatttcaaggacttgctggatcgtttggaggacaagatgcctttagaagatgaagttgca cccccacaaatactgagtgagcagactgatgaagccggggcagctctcagccccctccct gaggtacctccctggactggggaggtcagcccagcccagagagatgggggtgcccttggg cggagcccctgggactcctcggaaagatctgctctcctgaaaagcaagctgagggcgatg cttgctgcccctcggagcctgcggaggtccagctgctttgggggcaggatggacaggatt ggggcccagagtggactgggctgcaacagcttccggtaccgaagataa

DBGET integrated database retrieval system