Tupaia chinensis (Chinese tree shrew): 102479926 Help Entry 102479926         CDS       T02978                                  Symbol ACTB Name (RefSeq) actin beta   KO K05692   actin beta/gamma 1 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup03082   ATP-dependent chromatin remodeling tup04015   Rap1 signaling pathway tup04145   Phagosome tup04210   Apoptosis tup04390   Hippo signaling pathway tup04510   Focal adhesion tup04520   Adherens junction tup04530   Tight junction tup04611   Platelet activation tup04613   Neutrophil extracellular trap formation tup04670   Leukocyte transendothelial migration tup04714   Thermogenesis tup04810   Regulation of actin cytoskeleton tup04814   Motor proteins tup04820   Cytoskeleton in muscle cells tup04919   Thyroid hormone signaling pathway tup04921   Oxytocin signaling pathway tup04971   Gastric acid secretion tup05014   Amyotrophic lateral sclerosis tup05100   Bacterial invasion of epithelial cells tup05132   Salmonella infection tup05135   Yersinia infection tup05164   Influenza A tup05205   Proteoglycans in cancer tup05225   Hepatocellular carcinoma tup05410   Hypertrophic cardiomyopathy tup05412   Arrhythmogenic right ventricular cardiomyopathy tup05414   Dilated cardiomyopathy tup05416   Viral myocarditis tup05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102479926 (ACTB)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102479926 (ACTB)    04390 Hippo signaling pathway     102479926 (ACTB)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     102479926 (ACTB)   09143 Cell growth and death    04210 Apoptosis     102479926 (ACTB)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102479926 (ACTB)    04520 Adherens junction     102479926 (ACTB)    04530 Tight junction     102479926 (ACTB)   09142 Cell motility    04814 Motor proteins     102479926 (ACTB)    04820 Cytoskeleton in muscle cells     102479926 (ACTB)    04810 Regulation of actin cytoskeleton     102479926 (ACTB)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102479926 (ACTB)    04613 Neutrophil extracellular trap formation     102479926 (ACTB)    04670 Leukocyte transendothelial migration     102479926 (ACTB)   09152 Endocrine system    04921 Oxytocin signaling pathway     102479926 (ACTB)    04919 Thyroid hormone signaling pathway     102479926 (ACTB)   09154 Digestive system    04971 Gastric acid secretion     102479926 (ACTB)   09159 Environmental adaptation    04714 Thermogenesis     102479926 (ACTB)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102479926 (ACTB)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102479926 (ACTB)   09172 Infectious disease: viral    05164 Influenza A     102479926 (ACTB)   09171 Infectious disease: bacterial    05132 Salmonella infection     102479926 (ACTB)    05135 Yersinia infection     102479926 (ACTB)    05100 Bacterial invasion of epithelial cells     102479926 (ACTB)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102479926 (ACTB)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102479926 (ACTB)    05410 Hypertrophic cardiomyopathy     102479926 (ACTB)    05412 Arrhythmogenic right ventricular cardiomyopathy     102479926 (ACTB)    05414 Dilated cardiomyopathy     102479926 (ACTB)    05416 Viral myocarditis     102479926 (ACTB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tup03021]     102479926 (ACTB)    03019 Messenger RNA biogenesis [BR:tup03019]     102479926 (ACTB)    03036 Chromosome and associated proteins [BR:tup03036]     102479926 (ACTB)    03029 Mitochondrial biogenesis [BR:tup03029]     102479926 (ACTB)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tup04812]     102479926 (ACTB)    04147 Exosome [BR:tup04147]     102479926 (ACTB) Transcription machinery [BR:tup03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      102479926 (ACTB) Messenger RNA biogenesis [BR:tup03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      102479926 (ACTB) Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      102479926 (ACTB)     NuA4 complex      102479926 (ACTB)   Chromatin remodeling factors    BAF complex     102479926 (ACTB)    PBAF complex     102479926 (ACTB)    GBAF(ncBAF) complex     102479926 (ACTB)    SWR1 complex     102479926 (ACTB) Mitochondrial biogenesis [BR:tup03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     102479926 (ACTB) Cytoskeleton proteins [BR:tup04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      102479926 (ACTB) Exosome [BR:tup04147]  Exosomal proteins   Proteins found in most exosomes    102479926 (ACTB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  102479926 NCBI-ProteinID:  XP_006143676 UniProt:  L9L4N0 LinkDB All DBs Position Un AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKICHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgacgatattgctgcgctcgtcgttgacaatggctccggcatgtgcaaggccggt ttcgctggtgacgatgccccccgggccgtcttcccttccatcgtgggacgcccgcggcac cagggtgtgatggtaggcatgggccagaaggactcctatgtgggcgacgaggcccagagc aagagaggcatcctgaccctgaagtaccccatcgagcacggcattgtcaccaactgggac gacatggagaagatctgccatcacaccttctacaatgagctgcgtgtagcccccgaggag catcctgtgctgctgactgaggctcccctgaatcccaaggccaacagggagaagatgacc cagatcatgtttgagaccttcaacaccccagccatgtatgtggccatccaggctgtgctg tccctgtatgcctctggtcgtaccactggcatcgtgatggactccggtgacggggtcacc cacactgtgcccatctatgaggggtatgccctcccccatgccatccttcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctcacagagcgcggctacagcttc accaccacagccgagcgggaaattgtgcgtgacatcaaggagaagttgtgctatgtggcc ctagacttcgagcaggagatggccaccgccgcctccagctcctccctggaaaagagctac gagttgcctgatggtcaggtgatcaccattggcaatgagcggttccgctgtcctgaggca ctcttccagccatctttcctgggcatggaatcttgtggtatccacgaaaccaccttcaac tccatcatgaagtgtgatgtggacatccgtaaggacctgtatgccaacacagtcctgtct gggggcaccaccatgtatccaggcattgctgacagaatgcagaaggagataaccgccctg gcacctagcaccatgaagatcaagatcatcgctccccctgagcgcaaatactctgtgtgg atcggtggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtacgacgagtccggcccctccatcgtgcaccgcaaatgcttctag

DBGET integrated database retrieval system