Tupaia chinensis (Chinese tree shrew): 102481608 Help Entry 102481608         CDS       T02978                                  Symbol IGF2 Name (RefSeq) insulin like growth factor 2   KO K13769   insulin-like growth factor 2 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04010   MAPK signaling pathway tup04014   Ras signaling pathway tup04081   Hormone signaling tup04151   PI3K-Akt signaling pathway tup05200   Pathways in cancer tup05205   Proteoglycans in cancer tup05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102481608 (IGF2)    04014 Ras signaling pathway     102481608 (IGF2)    04151 PI3K-Akt signaling pathway     102481608 (IGF2)   09133 Signaling molecules and interaction    04081 Hormone signaling     102481608 (IGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102481608 (IGF2)    05205 Proteoglycans in cancer     102481608 (IGF2)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102481608 (IGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102481608 (IGF2)    00536 Glycosaminoglycan binding proteins [BR:tup00536]     102481608 (IGF2) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Growth factors (RTK binding)    102481608 (IGF2) Glycosaminoglycan binding proteins [BR:tup00536]  Heparan sulfate / Heparin   Growth factors/receptors    102481608 (IGF2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IGF2_C Insulin Motif Other DBs NCBI-GeneID:  102481608 NCBI-ProteinID:  XP_006141130 LinkDB All DBs Position Un AA seq 180 aa AA seqDB search MGIPMGKSMLVLLTFLAFASCCIAAFRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVN RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTSPTVLPDTIPRSSVGKFFQYDTRK QSTQRLRRGLSALLRARRGRMLARELEAFREVKRHRPLIALSTQDPAHGGASPEMSSNQK NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atggggatcccaatggggaagtcgatgctggtgctactcaccttcttggccttcgcctcg tgctgcattgctgctttccgccccagtgagaccctgtgcggcggggagctggtggacacc ctccagtttgtctgtggggaccgcggcttttacttcagcagacctgccagccgcgtgaac cgccgcagccgtggcattgttgaagagtgttgcttccgcagctgcgacctggcccttctg gagacctactgtgccacccccgccaagtccgagagggacgtgtcgacctctccgaccgtg cttccggacaccatccccagatcctccgtgggcaagttcttccaatatgacaccaggaag caatccactcagcgcctgcgcaggggcctgtctgcactcctgcgtgcccgccggggtcgc atgctcgccagggagctcgaagcgttcagagaggtcaagcgtcaccgtcccctgatcgcc ctgtccacccaagaccccgcccacgggggtgcctctcctgagatgtccagcaatcagaag tga

DBGET integrated database retrieval system