Tupaia chinensis (Chinese tree shrew): 102483320 Help Entry 102483320         CDS       T02978                                  Symbol MYL9 Name (RefSeq) myosin light chain 9   KO K12755   myosin regulatory light chain 9 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04022   cGMP-PKG signaling pathway tup04024   cAMP signaling pathway tup04270   Vascular smooth muscle contraction tup04360   Axon guidance tup04510   Focal adhesion tup04517   IgSF CAM signaling tup04520   Adherens junction tup04530   Tight junction tup04670   Leukocyte transendothelial migration tup04810   Regulation of actin cytoskeleton tup04814   Motor proteins tup04820   Cytoskeleton in muscle cells tup04921   Oxytocin signaling pathway tup05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102483320 (MYL9)    04022 cGMP-PKG signaling pathway     102483320 (MYL9)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102483320 (MYL9)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102483320 (MYL9)    04520 Adherens junction     102483320 (MYL9)    04530 Tight junction     102483320 (MYL9)   09142 Cell motility    04814 Motor proteins     102483320 (MYL9)    04820 Cytoskeleton in muscle cells     102483320 (MYL9)    04810 Regulation of actin cytoskeleton     102483320 (MYL9)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102483320 (MYL9)   09152 Endocrine system    04921 Oxytocin signaling pathway     102483320 (MYL9)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102483320 (MYL9)   09158 Development and regeneration    04360 Axon guidance     102483320 (MYL9)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102483320 (MYL9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tup04812]     102483320 (MYL9)    04147 Exosome [BR:tup04147]     102483320 (MYL9) Cytoskeleton proteins [BR:tup04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      102483320 (MYL9) Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of hepatic cells    102483320 (MYL9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_5 EF-hand_11 EF-hand_9 EF_EFCAB10_C EF-hand_FSTL1 GPHH EF-hand_EFHB_C WHD_2nd_Lhr SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  102483320 NCBI-ProteinID:  XP_006144153 LinkDB All DBs Position Un AA seq 172 aa AA seqDB search MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaagcgggccaaggccaagaccaccaagaagcggccacagcgggccacatcc aatgtctttgcgatgtttgatcagtcccagatccaggagtttaaggaggctttcaacatg atcgaccagaaccgtgatggcttcatcgacaaggaggacctacacgacatgctggcctca ctggggaagaatcccacggacgagtacctggagggcatgatgagcgaggccccggggccc atcaacttcaccatgttcctcaccatgttcggggagaagctgaacggcacggaccccgag gacgtgatccgcaacgcctttgcctgcttcgatgaggaggcctcaggctttatccacgag gaccaccttcgggagctgctcaccaccatgggtgaccgcttcacagacgaggaggtggac gagatgtaccgcgaggcgcccattgataagaaaggcaacttcaactacgtggagttcaca cgcatcctcaaacacggcgccaaggacaaggacgactag

DBGET integrated database retrieval system