Tupaia chinensis (Chinese tree shrew): 102483778 Help Entry 102483778         CDS       T02978                                  Symbol IL4 Name (RefSeq) interleukin 4   KO K05430   interleukin 4 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04151   PI3K-Akt signaling pathway tup04630   JAK-STAT signaling pathway tup04640   Hematopoietic cell lineage tup04657   IL-17 signaling pathway tup04658   Th1 and Th2 cell differentiation tup04659   Th17 cell differentiation tup04660   T cell receptor signaling pathway tup04664   Fc epsilon RI signaling pathway tup04672   Intestinal immune network for IgA production tup05140   Leishmaniasis tup05200   Pathways in cancer tup05310   Asthma tup05320   Autoimmune thyroid disease tup05321   Inflammatory bowel disease tup05330   Allograft rejection Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102483778 (IL4)    04151 PI3K-Akt signaling pathway     102483778 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102483778 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102483778 (IL4)    04660 T cell receptor signaling pathway     102483778 (IL4)    04658 Th1 and Th2 cell differentiation     102483778 (IL4)    04659 Th17 cell differentiation     102483778 (IL4)    04657 IL-17 signaling pathway     102483778 (IL4)    04664 Fc epsilon RI signaling pathway     102483778 (IL4)    04672 Intestinal immune network for IgA production     102483778 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102483778 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102483778 (IL4)   09163 Immune disease    05310 Asthma     102483778 (IL4)    05320 Autoimmune thyroid disease     102483778 (IL4)    05321 Inflammatory bowel disease     102483778 (IL4)    05330 Allograft rejection     102483778 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102483778 (IL4)    00536 Glycosaminoglycan binding proteins [BR:tup00536]     102483778 (IL4) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Interleukins    102483778 (IL4) Glycosaminoglycan binding proteins [BR:tup00536]  Heparan sulfate / Heparin   Cytokines    102483778 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  102483778 NCBI-ProteinID:  XP_006166982 LinkDB All DBs Position Un AA seq 122 aa AA seqDB search MGLVSRLMPALLCLLACASHSVHRRRCDKALVEIIKTLNILTASKTLCTEVTVADIFAAS KNTTEKETYCRAAAVLQPFYGHHGCLTEPKVARLLRGLNRNLHCLARSEDGQRLQTLEQG RG NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgggtctcgtctcccgactgatgcccgccctgctctgcctgctggcgtgtgccagccac tctgtccacagacgcagatgcgataaggccttagtagagatcatcaaaactctgaacatc ctcacagcgagcaagactctgtgcaccgaggtgaccgtagcagacatctttgccgcatcc aagaacacaaccgagaaggaaacctactgcagggctgcggctgtgcttcaaccgttctat ggccaccatgggtgtctcacagaacccaaagtggcccgactcctgagaggactcaacagg aacctccactgcctggcccgctcggaggacggccaacgcctgcagacgttggagcagggc agaggctag

DBGET integrated database retrieval system