Tupaia chinensis (Chinese tree shrew): 102483794 Help Entry 102483794         CDS       T02978                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup00670   One carbon pool by folate tup00790   Folate biosynthesis tup01100   Metabolic pathways tup01240   Biosynthesis of cofactors tup01523   Antifolate resistance tup04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:tup00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     102483794    00670 One carbon pool by folate     102483794  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     102483794  09160 Human Diseases   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102483794 Enzymes [BR:tup01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      102483794 SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  102483794 NCBI-ProteinID:  XP_014439756 LinkDB All DBs Position Un AA seq 138 aa AA seqDB search MGIGKNGDLPWPPLRNEFKYFQRTTTTSSVEGKQNTVIMGRKTWFSIPEKNRPLKDRINL VLSRELKEPPRGAHFLAKSLDDALKLIEQPELANQVDMVWIAGGGSVYKEAMNQPGHLKP FVTRIMQDFENDTFFSRN NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgggcatcggcaagaacggggacctgccctggcctccactcaggaatgaatttaagtat ttccagagaacgaccactacctcttcagtagaaggtaaacaaaataccgtgattatgggt aggaagacctggttttccattcctgaaaagaatcggcctttaaaggatagaattaattta gttctcagtagagaactcaaggaacctccacgaggagctcattttcttgccaaaagtctg gatgatgccctaaaacttattgagcagcctgaattagctaatcaagtggacatggtttgg atagcaggaggtggttctgtttataaggaagccatgaaccagccaggccatcttaaaccg ttcgtgacaaggatcatgcaggattttgaaaatgatacctttttttccagaaattga

DBGET integrated database retrieval system