Tupaia chinensis (Chinese tree shrew): 102489114 Help Entry 102489114         CDS       T02978                                  Symbol PTEN Name (RefSeq) phosphatase and tensin homolog   KO K01110   phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67] Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup00562   Inositol phosphate metabolism tup01100   Metabolic pathways tup01521   EGFR tyrosine kinase inhibitor resistance tup04068   FoxO signaling pathway tup04070   Phosphatidylinositol signaling system tup04071   Sphingolipid signaling pathway tup04115   p53 signaling pathway tup04140   Autophagy - animal tup04150   mTOR signaling pathway tup04151   PI3K-Akt signaling pathway tup04218   Cellular senescence tup04510   Focal adhesion tup04931   Insulin resistance tup05165   Human papillomavirus infection tup05166   Human T-cell leukemia virus 1 infection tup05200   Pathways in cancer tup05206   MicroRNAs in cancer tup05208   Chemical carcinogenesis - reactive oxygen species tup05213   Endometrial cancer tup05214   Glioma tup05215   Prostate cancer tup05218   Melanoma tup05222   Small cell lung cancer tup05224   Breast cancer tup05225   Hepatocellular carcinoma tup05230   Central carbon metabolism in cancer tup05235   PD-L1 expression and PD-1 checkpoint pathway in cancer tup05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:tup00001]  09100 Metabolism   09101 Carbohydrate metabolism    00562 Inositol phosphate metabolism     102489114 (PTEN)  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     102489114 (PTEN)    04070 Phosphatidylinositol signaling system     102489114 (PTEN)    04071 Sphingolipid signaling pathway     102489114 (PTEN)    04151 PI3K-Akt signaling pathway     102489114 (PTEN)    04150 mTOR signaling pathway     102489114 (PTEN)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102489114 (PTEN)   09143 Cell growth and death    04115 p53 signaling pathway     102489114 (PTEN)    04218 Cellular senescence     102489114 (PTEN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102489114 (PTEN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102489114 (PTEN)    05206 MicroRNAs in cancer     102489114 (PTEN)    05208 Chemical carcinogenesis - reactive oxygen species     102489114 (PTEN)    05230 Central carbon metabolism in cancer     102489114 (PTEN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102489114 (PTEN)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102489114 (PTEN)    05214 Glioma     102489114 (PTEN)    05218 Melanoma     102489114 (PTEN)    05215 Prostate cancer     102489114 (PTEN)    05213 Endometrial cancer     102489114 (PTEN)    05224 Breast cancer     102489114 (PTEN)    05222 Small cell lung cancer     102489114 (PTEN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102489114 (PTEN)    05165 Human papillomavirus infection     102489114 (PTEN)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     102489114 (PTEN)   09167 Endocrine and metabolic disease    04931 Insulin resistance     102489114 (PTEN)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102489114 (PTEN)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tup01009]     102489114 (PTEN) Enzymes [BR:tup01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.3  Phosphoric-monoester hydrolases     3.1.3.16  protein-serine/threonine phosphatase      102489114 (PTEN)     3.1.3.48  protein-tyrosine-phosphatase      102489114 (PTEN)     3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase      102489114 (PTEN) Protein phosphatases and associated proteins [BR:tup01009]  Protein tyrosine phosphatases (PTPs)   Class I PTPs (Dual specificity phosphatases)    Phosphatase and Tensin homologs (PTEN)     102489114 (PTEN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PTEN_C2 Tc-R-P DSPc PTP-SAK PTP-NADK Y_phosphatase PTPlike_phytase Y_phosphatase3 Y_phosphatase2 Motif Other DBs NCBI-GeneID:  102489114 NCBI-ProteinID:  XP_006169808 LinkDB All DBs Position Un AA seq 299 aa AA seqDB search MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMY FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQE NT seq 899 nt NT seq  +upstreamnt  +downstreamnt atgacagccatcatcaaagagatcgttagcagaaacaaaaggagatatcaagaggatgga ttcgacttagacttgacctatatttatccaaacattattgctatgggatttcctgcagaa agacttgaaggtgtatacaggaacaatattgatgatgtagtaaggtttttggattcaaag cataaaaaccattacaagatatacaatctatgtgctgaaagacattatgacaccgccaaa tttaactgcagagttgcacagtatccttttgaagaccataacccaccacagctagaactt atcaaacccttttgcgaagatcttgaccaatggctaagtgaagatgacaatcatgttgca gcaattcactgtaaagctggaaagggacgaactggtgtaatgatttgtgcatatttatta catcggggcaaatttttaaaggcacaggaggccctagatttctatggggaagtaaggacc agagacaaaaagggagtaactattcccagtcagaggcgctatgtgtattattatagctac ctgttaaagaatcatctggattatagaccagtggcactgttgtttcacaagatgatgttt gaaactattccaatgttcagtggcggaacttgcaatcctcagtttgtggtctgccagcta aaggtgaagatatattcctccaattcaggaccgacacgacgagaagacaagttcatgtac tttgagttccctcagccgttgcctgtgtgtggtgacatcaaagtcgagttcttccacaaa cagaacaagatgctaaaaaaggacaaaatgtttcacttttgggtaaatacgtttttcata ccaggaccagaggaaacctcagaaaaagtagaaaatggaagtctctgtgatcaagaaat

DBGET integrated database retrieval system