Tupaia chinensis (Chinese tree shrew): 102489799 Help Entry 102489799         CDS       T02978                                  Symbol FADD Name (RefSeq) Fas associated via death domain   KO K02373   FAS-associated death domain protein Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup01524   Platinum drug resistance tup04210   Apoptosis tup04215   Apoptosis - multiple species tup04217   Necroptosis tup04620   Toll-like receptor signaling pathway tup04621   NOD-like receptor signaling pathway tup04622   RIG-I-like receptor signaling pathway tup04623   Cytosolic DNA-sensing pathway tup04657   IL-17 signaling pathway tup04668   TNF signaling pathway tup04936   Alcoholic liver disease tup05010   Alzheimer disease tup05022   Pathways of neurodegeneration - multiple diseases tup05132   Salmonella infection tup05142   Chagas disease tup05152   Tuberculosis tup05160   Hepatitis C tup05161   Hepatitis B tup05162   Measles tup05163   Human cytomegalovirus infection tup05164   Influenza A tup05165   Human papillomavirus infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05168   Herpes simplex virus 1 infection tup05169   Epstein-Barr virus infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     102489799 (FADD)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102489799 (FADD)    04215 Apoptosis - multiple species     102489799 (FADD)    04217 Necroptosis     102489799 (FADD)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102489799 (FADD)    04621 NOD-like receptor signaling pathway     102489799 (FADD)    04622 RIG-I-like receptor signaling pathway     102489799 (FADD)    04623 Cytosolic DNA-sensing pathway     102489799 (FADD)    04657 IL-17 signaling pathway     102489799 (FADD)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102489799 (FADD)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102489799 (FADD)    05161 Hepatitis B     102489799 (FADD)    05160 Hepatitis C     102489799 (FADD)    05164 Influenza A     102489799 (FADD)    05162 Measles     102489799 (FADD)    05168 Herpes simplex virus 1 infection     102489799 (FADD)    05163 Human cytomegalovirus infection     102489799 (FADD)    05167 Kaposi sarcoma-associated herpesvirus infection     102489799 (FADD)    05169 Epstein-Barr virus infection     102489799 (FADD)    05165 Human papillomavirus infection     102489799 (FADD)   09171 Infectious disease: bacterial    05132 Salmonella infection     102489799 (FADD)    05152 Tuberculosis     102489799 (FADD)   09174 Infectious disease: parasitic    05142 Chagas disease     102489799 (FADD)   09164 Neurodegenerative disease    05010 Alzheimer disease     102489799 (FADD)    05022 Pathways of neurodegeneration - multiple diseases     102489799 (FADD)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102489799 (FADD)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102489799 (FADD) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DED Death EAL tRNA_NucTran2_2 Motif Other DBs NCBI-GeneID:  102489799 NCBI-ProteinID:  XP_006171299 UniProt:  L8XZZ6 LinkDB All DBs Position Un AA seq 208 aa AA seqDB search MDPFLVLLHSVSASLSSSELTELKFLCHGRVGKRKLERVESGLDLFSVLLEQNDLERERP DLLRELLTSLRRHDLLRRLDDFEAGARAGAGPKEEDLRAAFDIICENVGKDWRRLARQLK VSDTKIDGIEERYPRNLTEQVRESLRIWKNTQRDNATVVNLVKALRACEMNLVADLVEDE QQARDLQNGGEAASPMSWDSDVSTSGAP NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggacccgttcctggtgctgctgcactcggtgtcggccagcctgtctagcagcgagctg acggagctgaagttcctgtgccacgggcgtgtgggcaagaggaagctggagcgcgtggag agcggcctcgacctcttctccgtgctgctggagcagaacgacctggagcgcgagcgccct gacctgctgcgcgagctgctcacctccctgcggcgccacgacctgctgcggcgcctggac gacttcgaggcgggcgcccgggcgggagctgggcccaaagaggaagatctgcgtgcagcg tttgacatcatatgtgaaaatgtggggaaagactggagaagattggctcgtcagcttaag gtttctgacaccaagatcgatggcatcgaggagcggtatccccgtaacctcacggaacag gtgagagaatcactgcggatctggaagaacacccagagggacaatgcgaccgtggtcaac ctggtgaaagcacttagggcctgcgagatgaacctggtggctgacctcgtggaggacgag cagcaggcccgggacctccagaacgggggtgaggctgcatccccgatgtcctgggattcg gacgtgtccacctcaggggcaccctga

DBGET integrated database retrieval system