Tupaia chinensis (Chinese tree shrew): 102493291 Help Entry 102493291         CDS       T02978                                  Symbol CDK4 Name (RefSeq) cyclin dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup01522   Endocrine resistance tup04110   Cell cycle tup04115   p53 signaling pathway tup04151   PI3K-Akt signaling pathway tup04218   Cellular senescence tup04530   Tight junction tup04660   T cell receptor signaling pathway tup04933   AGE-RAGE signaling pathway in diabetic complications tup04934   Cushing syndrome tup05160   Hepatitis C tup05162   Measles tup05163   Human cytomegalovirus infection tup05164   Influenza A tup05165   Human papillomavirus infection tup05166   Human T-cell leukemia virus 1 infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05169   Epstein-Barr virus infection tup05200   Pathways in cancer tup05203   Viral carcinogenesis tup05212   Pancreatic cancer tup05214   Glioma tup05218   Melanoma tup05219   Bladder cancer tup05220   Chronic myeloid leukemia tup05222   Small cell lung cancer tup05223   Non-small cell lung cancer tup05224   Breast cancer tup05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     102493291 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102493291 (CDK4)    04115 p53 signaling pathway     102493291 (CDK4)    04218 Cellular senescence     102493291 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     102493291 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     102493291 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102493291 (CDK4)    05203 Viral carcinogenesis     102493291 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     102493291 (CDK4)    05225 Hepatocellular carcinoma     102493291 (CDK4)    05214 Glioma     102493291 (CDK4)    05220 Chronic myeloid leukemia     102493291 (CDK4)    05218 Melanoma     102493291 (CDK4)    05219 Bladder cancer     102493291 (CDK4)    05224 Breast cancer     102493291 (CDK4)    05222 Small cell lung cancer     102493291 (CDK4)    05223 Non-small cell lung cancer     102493291 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102493291 (CDK4)    05160 Hepatitis C     102493291 (CDK4)    05164 Influenza A     102493291 (CDK4)    05162 Measles     102493291 (CDK4)    05163 Human cytomegalovirus infection     102493291 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     102493291 (CDK4)    05169 Epstein-Barr virus infection     102493291 (CDK4)    05165 Human papillomavirus infection     102493291 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102493291 (CDK4)    04934 Cushing syndrome     102493291 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102493291 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:tup01001]     102493291 (CDK4) Enzymes [BR:tup01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      102493291 (CDK4) Protein kinases [BR:tup01001]  Serine/threonine kinases: CMGC group   CDK family    102493291 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  102493291 NCBI-ProteinID:  XP_006171943 LinkDB All DBs Position Un AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKASPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLSKIFDLIGLPPEDDWPR DVSLPRGAFSPRVPRPVQSVVPEMEETGAQLLLEMLTFNPHKRISAFRALQHSYLHKEEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcgatatgagccagtggctgaaattggtgttggtgcctatgggaccgtg tacaaggcccgggatccccacagtggccactttgtggccctcaagagtgtgagagtcccc aatggaggaggagctggagggggccttcccatcagcacagttcgtgaggtggctttattg aggcggctggaggcttttgagcatcccaacgttgtcaggctgatggatgtttgtgccacc tctcgaactgaccgggagatcaaggtgaccctggtgtttgagcatgtagaccaagaccta aggacatatctggacaaggcatccccaccaggcttgccagtggagaccatcaaggatctg atgcgccagtttctaagaggcctagatttccttcatgccaattgcattgttcaccgagac ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacctgtggttgttacactctggtac cgtgcccccgaagttcttctgcagtctacatatgcaacacctgtggatatgtggagtgtt ggctgtatctttgcagagatgttccgtcgaaagcctctcttctgtggaaattctgaagct gaccagttgagcaaaatttttgacctaattgggctgcctccagaggatgactggccccga gatgtctctctaccccgaggagccttttcccccagagtgccccgcccggtgcagtcagtg gtgcctgagatggaggagactggagcacaactattgctggaaatgctgacttttaaccca cacaagcgaatctctgccttccgagctctgcagcactcttatctacataaggaagaaggt aatcctgagtga

DBGET integrated database retrieval system