Tupaia chinensis (Chinese tree shrew): 102493858 Help Entry 102493858         CDS       T02978                                  Symbol IFNB1 Name (RefSeq) interferon beta 1   KO K05415   interferon beta Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04151   PI3K-Akt signaling pathway tup04217   Necroptosis tup04380   Osteoclast differentiation tup04620   Toll-like receptor signaling pathway tup04621   NOD-like receptor signaling pathway tup04622   RIG-I-like receptor signaling pathway tup04623   Cytosolic DNA-sensing pathway tup04630   JAK-STAT signaling pathway tup04650   Natural killer cell mediated cytotoxicity tup04668   TNF signaling pathway tup04936   Alcoholic liver disease tup05135   Yersinia infection tup05142   Chagas disease tup05152   Tuberculosis tup05160   Hepatitis C tup05161   Hepatitis B tup05162   Measles tup05163   Human cytomegalovirus infection tup05164   Influenza A tup05165   Human papillomavirus infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05168   Herpes simplex virus 1 infection tup05169   Epstein-Barr virus infection tup05170   Human immunodeficiency virus 1 infection tup05171   Coronavirus disease - COVID-19 tup05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102493858 (IFNB1)    04668 TNF signaling pathway     102493858 (IFNB1)    04151 PI3K-Akt signaling pathway     102493858 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102493858 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102493858 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102493858 (IFNB1)    04621 NOD-like receptor signaling pathway     102493858 (IFNB1)    04622 RIG-I-like receptor signaling pathway     102493858 (IFNB1)    04623 Cytosolic DNA-sensing pathway     102493858 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     102493858 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     102493858 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102493858 (IFNB1)    05161 Hepatitis B     102493858 (IFNB1)    05160 Hepatitis C     102493858 (IFNB1)    05171 Coronavirus disease - COVID-19     102493858 (IFNB1)    05164 Influenza A     102493858 (IFNB1)    05162 Measles     102493858 (IFNB1)    05168 Herpes simplex virus 1 infection     102493858 (IFNB1)    05163 Human cytomegalovirus infection     102493858 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     102493858 (IFNB1)    05169 Epstein-Barr virus infection     102493858 (IFNB1)    05165 Human papillomavirus infection     102493858 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     102493858 (IFNB1)    05152 Tuberculosis     102493858 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     102493858 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102493858 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102493858 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102493858 (IFNB1) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Interferons    102493858 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DNA_pol_B_palm Motif Other DBs NCBI-GeneID:  102493858 NCBI-ProteinID:  XP_006140391 UniProt:  L9LC61 LinkDB All DBs Position Un AA seq 187 aa AA seqDB search MFYRSILQIALLLCLSTTTLSLSYNMLRFQLSGSSLACKKFLQQLGGVPEDCLKDRMSFE VPEEIQRPQQFQKENATLVIHEMLQNIFGVFRRNFSSTGWNDTIVEHLLAQLFWQMDHLE TMLEEKLEEENVTWGNSMSVMHLKSYYLRITQYLKAKEYSSCAWTIVRVEILRNFLFINR LIDYLRD NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgttctacagaagcatcctccaaatcgctctcctgttgtgcctctccaccaccactctt tctctgagctacaacatgcttcgattccaactaagtggcagcagtttggcgtgtaagaag ttcctacagcagttgggtggcgtacctgaagactgcctcaaggaccgtatgagcttcgag gtccctgaggaaattcaacgaccacagcagttccagaaagagaacgctacattggtcatc catgagatgctccagaacatctttggtgttttcagaagaaatttctctagcactggctgg aatgataccattgtagagcacctccttgctcaactcttttggcagatggaccacttggaa accatgctggaagaaaagctagaggaggaaaacgtcacctggggaaacagcatgagcgtc atgcacctgaagagctattatttgaggattacacaatacctgaaggccaaggagtacagc agctgtgcctggacgatagtccgagtggaaatcctcaggaactttttgttcattaacaga cttatagactacctccgagactga

DBGET integrated database retrieval system