Tupaia chinensis (Chinese tree shrew): 102498607 Help Entry 102498607         CDS       T02978                                  Symbol CD3D Name (RefSeq) CD3d molecule   KO K06450   T-cell surface glycoprotein CD3 delta chain Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04640   Hematopoietic cell lineage tup04658   Th1 and Th2 cell differentiation tup04659   Th17 cell differentiation tup04660   T cell receptor signaling pathway tup05142   Chagas disease tup05162   Measles tup05166   Human T-cell leukemia virus 1 infection tup05169   Epstein-Barr virus infection tup05170   Human immunodeficiency virus 1 infection tup05235   PD-L1 expression and PD-1 checkpoint pathway in cancer tup05340   Primary immunodeficiency Brite KEGG Orthology (KO) [BR:tup00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102498607 (CD3D)    04660 T cell receptor signaling pathway     102498607 (CD3D)    04658 Th1 and Th2 cell differentiation     102498607 (CD3D)    04659 Th17 cell differentiation     102498607 (CD3D)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102498607 (CD3D)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102498607 (CD3D)    05170 Human immunodeficiency virus 1 infection     102498607 (CD3D)    05162 Measles     102498607 (CD3D)    05169 Epstein-Barr virus infection     102498607 (CD3D)   09174 Infectious disease: parasitic    05142 Chagas disease     102498607 (CD3D)   09163 Immune disease    05340 Primary immunodeficiency     102498607 (CD3D)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:tup04090]     102498607 (CD3D) CD molecules [BR:tup04090]  Proteins   102498607 (CD3D) SSDB OrthologParalogGFIT Motif Pfam:  Ig_4 ITAM Ig_5 DUF325 RsgA_N Motif Other DBs NCBI-GeneID:  102498607 NCBI-ProteinID:  XP_006148902 LinkDB All DBs Position Un AA seq 172 aa AA seqDB search MAHRGLLAGLMLAAFLPHVSPFNIIVEELEDKVLVNCNTSITQLEGTMGTFFSDDKQQLD LGRYILDPRGVYQCRGTGNFAKKVSTLQIYYRMCQNCVELDSATMAGIIITDIIATLLLA LGVYCFAGHETGRLSEAADTQILLRNDQLYQTLGDRDDAQYSHLGGNWSRNK NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atggcacacaggggccttctggctggcctcatgctggctgcctttctccctcatgtaagc cccttcaatataattgtggaggaacttgaggacaaagtgttggtgaactgcaataccagc atcacacagctagaggggacgatgggaaccttcttctcagatgataaacaacagctggac ttgggaagatacatcctggacccacgaggagtataccagtgtagagggacaggcaacttt gccaaaaaagtgtctactctgcaaatatattatcgaatgtgccagaattgtgtggagctg gactcggccaccatggctggcatcatcatcactgacatcattgccactctgctcctcgct ttaggagtctactgctttgctggacatgagactggaaggctctctgaggctgctgacact caaattctgttgaggaatgatcaactctatcagaccctcggagaccgggatgatgctcag tacagccatcttggagggaactggtctcggaacaaatga

DBGET integrated database retrieval system