Tupaia chinensis (Chinese tree shrew): 102499711 Help Entry 102499711         CDS       T02978                                  Symbol CXCL12, SDF-1 Name (RefSeq) C-X-C motif chemokine ligand 12   KO K10031   C-X-C motif chemokine 12 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup04060   Cytokine-cytokine receptor interaction tup04061   Viral protein interaction with cytokine and cytokine receptor tup04062   Chemokine signaling pathway tup04064   NF-kappa B signaling pathway tup04360   Axon guidance tup04670   Leukocyte transendothelial migration tup04672   Intestinal immune network for IgA production tup04810   Regulation of actin cytoskeleton tup05163   Human cytomegalovirus infection tup05200   Pathways in cancer tup05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102499711 (CXCL12)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102499711 (CXCL12)    04061 Viral protein interaction with cytokine and cytokine receptor     102499711 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102499711 (CXCL12)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102499711 (CXCL12)    04672 Intestinal immune network for IgA production     102499711 (CXCL12)    04062 Chemokine signaling pathway     102499711 (CXCL12)   09158 Development and regeneration    04360 Axon guidance     102499711 (CXCL12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102499711 (CXCL12)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102499711 (CXCL12)   09163 Immune disease    05323 Rheumatoid arthritis     102499711 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tup04052]     102499711 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:tup00536]     102499711 (CXCL12) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Chemokines    102499711 (CXCL12) Glycosaminoglycan binding proteins [BR:tup00536]  Heparan sulfate / Heparin   Chemokines    102499711 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102499711 NCBI-ProteinID:  XP_014443038 LinkDB All DBs Position Un AA seq 89 aa AA seqDB search MDAKVVALLALVLAALCRSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV ARLKNNNRQVCIDPKLKWIQEYLEKALNK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggacgccaaggtcgtcgccttgctggccctcgtgctggccgcgctctgccgcagcgac gggaagcccgtcagcctgagctacagatgtccatgccgattcttcgagagccatgttgcc agagccaacgtcaagcatctcaaaattctcaacactcccaactgcgcccttcagattgtg gcaaggctgaagaacaacaacagacaagtgtgcattgatccgaaattaaagtggattcag gagtacctggagaaagctttaaacaagtaa

DBGET integrated database retrieval system