Tupaia chinensis (Chinese tree shrew): 102502195 Help Entry 102502195         CDS       T02978                                  Symbol PLA2G2E Name (RefSeq) phospholipase A2 group IIE   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup00564   Glycerophospholipid metabolism tup00565   Ether lipid metabolism tup00590   Arachidonic acid metabolism tup00591   Linoleic acid metabolism tup00592   alpha-Linolenic acid metabolism tup01100   Metabolic pathways tup04014   Ras signaling pathway tup04270   Vascular smooth muscle contraction tup04972   Pancreatic secretion tup04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:tup00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     102502195 (PLA2G2E)    00565 Ether lipid metabolism     102502195 (PLA2G2E)    00590 Arachidonic acid metabolism     102502195 (PLA2G2E)    00591 Linoleic acid metabolism     102502195 (PLA2G2E)    00592 alpha-Linolenic acid metabolism     102502195 (PLA2G2E)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102502195 (PLA2G2E)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     102502195 (PLA2G2E)   09154 Digestive system    04972 Pancreatic secretion     102502195 (PLA2G2E)    04975 Fat digestion and absorption     102502195 (PLA2G2E)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tup03036]     102502195 (PLA2G2E) Enzymes [BR:tup01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      102502195 (PLA2G2E) Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     102502195 (PLA2G2E) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_4 Motif Other DBs NCBI-GeneID:  102502195 NCBI-ProteinID:  XP_006145262 LinkDB All DBs Position Un AA seq 142 aa AA seqDB search MKPPPVLTLLCILVALAGGNLVQFGVMIERMTGKPALQYNDYGCYCGIGGSHWPVDQTDW CCHAHDCCYGRLEKLGCEPKLEKYLFSVGKDNIFCAGRTTCQRQTCECDRRAALCFRRHL GTYNRKYAHYPNKLCTGPTPPC NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgaaacctccccctgttctgactttgctttgcatcctggtggccctggccggcgggaac ctggtgcagttcggggtgatgatcgagcggatgacggggaagccagccctgcagtacaac gactacggctgctactgcggcatcggtggctcccactggccggtggaccagaccgactgg tgctgccacgcccacgactgctgctatgggcggctggagaagctaggctgtgagcccaaa ctggagaagtacctcttctctgtcggcaaggacaacatcttctgtgccggcagaaccacc tgccagaggcagacctgcgagtgcgaccggagggctgcactctgcttccgccgccacctg ggcacctacaaccgcaagtacgcccactaccccaacaagctgtgcaccgggccaaccccg ccctgctga

DBGET integrated database retrieval system