Tupaia chinensis (Chinese tree shrew): 102502878 Help Entry 102502878         CDS       T02978                                  Symbol FASLG Name (RefSeq) Fas ligand   KO K04389   tumor necrosis factor ligand superfamily member 6 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup01524   Platinum drug resistance tup04010   MAPK signaling pathway tup04014   Ras signaling pathway tup04060   Cytokine-cytokine receptor interaction tup04068   FoxO signaling pathway tup04151   PI3K-Akt signaling pathway tup04210   Apoptosis tup04217   Necroptosis tup04650   Natural killer cell mediated cytotoxicity tup04722   Neurotrophin signaling pathway tup04932   Non-alcoholic fatty liver disease tup04936   Alcoholic liver disease tup04940   Type I diabetes mellitus tup05022   Pathways of neurodegeneration - multiple diseases tup05142   Chagas disease tup05143   African trypanosomiasis tup05160   Hepatitis C tup05161   Hepatitis B tup05162   Measles tup05163   Human cytomegalovirus infection tup05164   Influenza A tup05165   Human papillomavirus infection tup05168   Herpes simplex virus 1 infection tup05170   Human immunodeficiency virus 1 infection tup05200   Pathways in cancer tup05205   Proteoglycans in cancer tup05320   Autoimmune thyroid disease tup05330   Allograft rejection tup05332   Graft-versus-host disease tup05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102502878 (FASLG)    04014 Ras signaling pathway     102502878 (FASLG)    04068 FoxO signaling pathway     102502878 (FASLG)    04151 PI3K-Akt signaling pathway     102502878 (FASLG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102502878 (FASLG)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102502878 (FASLG)    04217 Necroptosis     102502878 (FASLG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     102502878 (FASLG)   09156 Nervous system    04722 Neurotrophin signaling pathway     102502878 (FASLG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102502878 (FASLG)    05205 Proteoglycans in cancer     102502878 (FASLG)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102502878 (FASLG)    05161 Hepatitis B     102502878 (FASLG)    05160 Hepatitis C     102502878 (FASLG)    05164 Influenza A     102502878 (FASLG)    05162 Measles     102502878 (FASLG)    05168 Herpes simplex virus 1 infection     102502878 (FASLG)    05163 Human cytomegalovirus infection     102502878 (FASLG)    05165 Human papillomavirus infection     102502878 (FASLG)   09174 Infectious disease: parasitic    05142 Chagas disease     102502878 (FASLG)    05143 African trypanosomiasis     102502878 (FASLG)   09163 Immune disease    05320 Autoimmune thyroid disease     102502878 (FASLG)    05330 Allograft rejection     102502878 (FASLG)    05332 Graft-versus-host disease     102502878 (FASLG)   09164 Neurodegenerative disease    05022 Pathways of neurodegeneration - multiple diseases     102502878 (FASLG)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102502878 (FASLG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102502878 (FASLG)    04936 Alcoholic liver disease     102502878 (FASLG)    04932 Non-alcoholic fatty liver disease     102502878 (FASLG)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102502878 (FASLG)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tup04147]     102502878 (FASLG)    04052 Cytokines and neuropeptides [BR:tup04052]     102502878 (FASLG)    04090 CD molecules [BR:tup04090]     102502878 (FASLG) Exosome [BR:tup04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102502878 (FASLG) Cytokines and neuropeptides [BR:tup04052]  Cytokines   Tumor necrosis fators    102502878 (FASLG) CD molecules [BR:tup04090]  Proteins   102502878 (FASLG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Lectin_N Motif Other DBs NCBI-GeneID:  102502878 NCBI-ProteinID:  XP_006142410 LinkDB All DBs Position Un AA seq 282 aa AA seqDB search MQQPFNYPYPQIYWVDSSASSPWTPPGSVLPCPSSVPNRPGQRRPPPLPPAPPPPLPPPP PPALPPLPPPPLKKRREHNPGLCLLVMFFMVLVVLVGMGLGMFQLFHLQKELAELRESTS QRHTVSSLEKQIGGPSPPSEKKELRKVAHVTGKPNSRSNPLQWEDTYGVALISGVKYKKG GLVINDTGLYFVYSKVYFRGQSCNNQPLSHKVYMRNSKYPQDLVLMEGKMMNYCTTGQMW ARSSYLGAVFNLTSADCLYVNVSELSLVSFEESKTFFGLYKL NT seq 849 nt NT seq  +upstreamnt  +downstreamnt atgcagcagcccttcaattatccatatccccaaatttactgggtggatagcagtgccagc agtccctggacccctccagggtcagtcctcccctgtccatcctccgtgcccaacaggcca ggccaaaggaggccaccgccgctgccgccagcaccaccaccaccactgcccccaccgcca cctccagcgctgcccccactgcctcctccacctctgaagaagagaagggagcacaaccca ggcctctgtctccttgtgatgtttttcatggttctggtggtcctggttggaatgggcctg gggatgtttcagctcttccacctacagaaggaactggccgaactccgagagtccaccagc caaaggcacacagtatcatctttggaaaagcaaataggtggccccagtcctccttctgaa aaaaaggagctgaggaaagtggcccatgtaacaggcaagcccaactcaaggtccaaccct ctgcaatgggaagacacctatggagttgccctgatctccggagtgaagtataagaagggt ggccttgtgatcaatgacactgggctgtactttgtgtattccaaagtgtacttccggggt cagtcctgcaacaaccagcccctgagccacaaggtttacatgaggaactctaagtatccc caggatctggtgctgatggaggggaagatgatgaactactgcaccactggccaaatgtgg gcccgtagcagctacttgggggcagtattcaatctcaccagtgccgattgcttatatgtc aatgtgtctgagctctctctggtcagttttgaggaatcaaagacattttttggcttatat aagctctaa

DBGET integrated database retrieval system