Tupaia chinensis (Chinese tree shrew): 102503238 Help Entry 102503238         CDS       T02978                                  Symbol TP53, p53 Name (RefSeq) tumor protein p53   KO K04451   tumor protein p53 Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup01522   Endocrine resistance tup01524   Platinum drug resistance tup04010   MAPK signaling pathway tup04071   Sphingolipid signaling pathway tup04110   Cell cycle tup04115   p53 signaling pathway tup04137   Mitophagy - animal tup04151   PI3K-Akt signaling pathway tup04210   Apoptosis tup04211   Longevity regulating pathway tup04216   Ferroptosis tup04218   Cellular senescence tup04310   Wnt signaling pathway tup04722   Neurotrophin signaling pathway tup04919   Thyroid hormone signaling pathway tup05012   Parkinson disease tup05014   Amyotrophic lateral sclerosis tup05016   Huntington disease tup05160   Hepatitis C tup05161   Hepatitis B tup05162   Measles tup05163   Human cytomegalovirus infection tup05165   Human papillomavirus infection tup05166   Human T-cell leukemia virus 1 infection tup05167   Kaposi sarcoma-associated herpesvirus infection tup05168   Herpes simplex virus 1 infection tup05169   Epstein-Barr virus infection tup05200   Pathways in cancer tup05202   Transcriptional misregulation in cancer tup05203   Viral carcinogenesis tup05205   Proteoglycans in cancer tup05206   MicroRNAs in cancer tup05210   Colorectal cancer tup05212   Pancreatic cancer tup05213   Endometrial cancer tup05214   Glioma tup05215   Prostate cancer tup05216   Thyroid cancer tup05217   Basal cell carcinoma tup05218   Melanoma tup05219   Bladder cancer tup05220   Chronic myeloid leukemia tup05222   Small cell lung cancer tup05223   Non-small cell lung cancer tup05224   Breast cancer tup05225   Hepatocellular carcinoma tup05226   Gastric cancer tup05230   Central carbon metabolism in cancer tup05417   Lipid and atherosclerosis tup05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102503238 (TP53)    04310 Wnt signaling pathway     102503238 (TP53)    04071 Sphingolipid signaling pathway     102503238 (TP53)    04151 PI3K-Akt signaling pathway     102503238 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102503238 (TP53)   09143 Cell growth and death    04110 Cell cycle     102503238 (TP53)    04210 Apoptosis     102503238 (TP53)    04216 Ferroptosis     102503238 (TP53)    04115 p53 signaling pathway     102503238 (TP53)    04218 Cellular senescence     102503238 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     102503238 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     102503238 (TP53)   09149 Aging    04211 Longevity regulating pathway     102503238 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102503238 (TP53)    05202 Transcriptional misregulation in cancer     102503238 (TP53)    05206 MicroRNAs in cancer     102503238 (TP53)    05205 Proteoglycans in cancer     102503238 (TP53)    05203 Viral carcinogenesis     102503238 (TP53)    05230 Central carbon metabolism in cancer     102503238 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     102503238 (TP53)    05212 Pancreatic cancer     102503238 (TP53)    05225 Hepatocellular carcinoma     102503238 (TP53)    05226 Gastric cancer     102503238 (TP53)    05214 Glioma     102503238 (TP53)    05216 Thyroid cancer     102503238 (TP53)    05220 Chronic myeloid leukemia     102503238 (TP53)    05217 Basal cell carcinoma     102503238 (TP53)    05218 Melanoma     102503238 (TP53)    05219 Bladder cancer     102503238 (TP53)    05215 Prostate cancer     102503238 (TP53)    05213 Endometrial cancer     102503238 (TP53)    05224 Breast cancer     102503238 (TP53)    05222 Small cell lung cancer     102503238 (TP53)    05223 Non-small cell lung cancer     102503238 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102503238 (TP53)    05161 Hepatitis B     102503238 (TP53)    05160 Hepatitis C     102503238 (TP53)    05162 Measles     102503238 (TP53)    05168 Herpes simplex virus 1 infection     102503238 (TP53)    05163 Human cytomegalovirus infection     102503238 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     102503238 (TP53)    05169 Epstein-Barr virus infection     102503238 (TP53)    05165 Human papillomavirus infection     102503238 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     102503238 (TP53)    05014 Amyotrophic lateral sclerosis     102503238 (TP53)    05016 Huntington disease     102503238 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102503238 (TP53)    05418 Fluid shear stress and atherosclerosis     102503238 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102503238 (TP53)    01522 Endocrine resistance     102503238 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:tup03000]     102503238 (TP53)    03036 Chromosome and associated proteins [BR:tup03036]     102503238 (TP53)    03400 DNA repair and recombination proteins [BR:tup03400]     102503238 (TP53) Transcription factors [BR:tup03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     102503238 (TP53) Chromosome and associated proteins [BR:tup03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      102503238 (TP53) DNA repair and recombination proteins [BR:tup03400]  Eukaryotic type   Check point factors    Other check point factors     102503238 (TP53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer TAD2 P53_TAD Motif Other DBs NCBI-GeneID:  102503238 NCBI-ProteinID:  NP_001274298 UniProt:  Q9TTA1 LinkDB All DBs Position Un AA seq 393 aa AA seqDB search MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP DEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAK SVTCTYSPDLNKLFCQLAKTCPVQLWVDSAPPPGTRVRAMAIYKQSQYVTEVVRRCPHHE RCSDSDGLAPPQHLIRVEGNLHAEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS SCMGGMNRRPILTIITLEDSSGKLLGRNSFEVRICACPGRDRRTEEENFRKKGESCPKLP TGSIKRALPTGSSSSPQPKKKPLDEEYFTLQIRGRERFEMLREINEALELKDAMAGKESA GSRAHSSHLKSKKGQSTSRHRKLMFKTEGPDSD NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt atggaggagccgcagtcagatcctagcgtcgagccccctctgagtcaggaaacattttca gacctatggaaactacttcctgaaaacaacgttctgtcccccttgccgtcccaagcaatg gatgatttgatgctgtccccggacgatattgaacaatggttcactgaagacccaggtcca gatgaagctcccagaatgccagaggctgctccccccgtggcccctgcaccagcagctcct acaccggcggcccctgcaccagccccctcctggcccctgtcatcttctgtcccttcccag aaaacctaccagggcagctacggtttccgtctgggcttcttgcattctgggacagccaag tctgtcacctgcacgtattccccggacctcaacaagctgttttgccagctagcaaagacc tgccccgtgcagctgtgggtggactcggcgcccccgcccggcacccgtgtccgggccatg gccatctacaagcagtcacaatacgtgacagaggtcgtgagacgctgcccccaccacgag cgctgctctgacagcgatggtctggccccgcctcagcatcttatccgggtggaaggaaac ctgcacgcggagtattcggatgacagaaacactttccgacacagtgtggtagtgccctac gagccgcccgaggtcggctctgactgcaccaccatccactacaactacatgtgcaacagc tcctgcatgggcggcatgaaccggcgccccatcctcactattatcacgctggaggactcc agtgggaagctgctaggacggaacagcttcgaggtacgcatttgtgcctgtcctggaaga gaccgacgcacagaggaagaaaatttccgcaagaaaggggagtcttgtcccaagctgccc actgggagcattaagcgagcactgccgactggttccagctcttctccacagccaaagaag aaaccactggatgaagagtatttcacccttcagattcgtgggcgtgaacgcttcgagatg ctgcgagaaattaatgaggccttggaactcaaggatgccatggctgggaaagagtcagcg ggcagcagggctcattctagccacctgaagtccaagaagggccagtctacctcccgccat agaaaactaatgttcaaaacagagggacctgactcagactga

DBGET integrated database retrieval system