KEGG   Trichophyton verrucosum: TRV_00552
Entry
TRV_00552         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K04126  isopenicillin-N synthase [EC:1.21.3.1]
Organism
tve  Trichophyton verrucosum
Pathway
tve00311  Penicillin and cephalosporin biosynthesis
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
Module
tve_M00672  Penicillin biosynthesis, aminoadipate + cycteine + valine => penicillin
Brite
KEGG Orthology (KO) [BR:tve00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    TRV_00552
Enzymes [BR:tve01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.1  isopenicillin-N synthase
     TRV_00552
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 9580767
NCBI-ProteinID: XP_003025275
UniProt: D4D0F7
LinkDB
AA seq 333 aa
MSTTPVADVPRINVSPLFGDNMAEKMKVARAIDAASRGSGFFYAVGHGVDVNRLTEETRK
FHLSITDEEKWQLAIRAYNKEHEKQIRSGYYLPIRGKKAVESFCYLNPNYSSDHPRIQQG
TPFHEVNVWPDEDKHPGFRQFAEQYYWDVFGLSSALLRGYALALGKEEDFFTKHFRKHDT
LSSVVLIRYPYIEDYPAPAIKTASDGTKLSFEWHEDVSLITVLYQSQVQNLQVQTPEGWL
DIEADDTGYLVNCGSYMAHITNNFYPAPIHRVKFVNAERQSLPFFVNLGFDDVVEPWNPG
SNSQNSETARKPIPYGQYLQDGLIGLIKKNGQT
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtcaacgaccccagttgctgacgttcctcgaatcaatgtctctcccctatttggtgat
aatatggcggagaagatgaaagttgctcgtgctattgatgcagcctcgcgcgggtcaggt
ttcttctacgcagtcggccatggggtcgatgtcaatcgcctcacggaggagacccggaaa
ttccacctctctattaccgacgaggagaagtggcagctcgccattcgggcgtacaataaa
gaacacgaaaagcagattcgcagtggctactatttgcccatccgtgggaagaaggctgtc
gagtcattctgttatctcaatcccaactacagctccgaccatccccgcattcagcagggc
acaccgtttcacgaggtgaatgtctggccagacgaggacaagcacccaggtttccggcaa
tttgccgagcagtattactgggatgtgtttggcctctcctcggccctcttgcgtggttac
gcacttgcccttggcaaggaagaggactttttcaccaagcactttcgaaagcatgatacg
ctgtcctcagtggtccttatcagatacccttatatcgaggactacccggctcctgcaata
aaaactgccagcgatggcacgaagctcagcttcgagtggcacgaagacgtttcccttatc
accgtcctgtatcaatcccaggttcaaaacctacaggtgcagacgccggagggctggctg
gatatcgaagctgacgacaccggataccttgtcaactgcggaagctacatggcccatatc
actaacaacttctacccggcgcccattcatcgtgtcaaattcgtgaacgcagagcgccaa
tcccttcccttctttgtcaacctggggtttgatgacgttgttgagccgtggaacccaggc
tccaactctcagaactccgagacagccaggaagcctattccgtatggccagtacttgcag
gatggtctgattggcttgatcaagaagaacgggcagacctaa

DBGET integrated database retrieval system