Trichophyton verrucosum: TRV_07648 Help Entry TRV_07648         CDS       T01615                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism tve  Trichophyton verrucosum Pathway tve03420   Nucleotide excision repair tve04111   Cell cycle - yeast tve04120   Ubiquitin mediated proteolysis tve04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:tve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     TRV_07648    04120 Ubiquitin mediated proteolysis     TRV_07648   09124 Replication and repair    03420 Nucleotide excision repair     TRV_07648  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     TRV_07648  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tve04121]     TRV_07648    03400 DNA repair and recombination proteins [BR:tve03400]     TRV_07648 Enzymes [BR:tve01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      TRV_07648 Ubiquitin system [BR:tve04121]  Ubiquitin ligases (E3)   UBL E3 ligases    TRV_07648   Multi subunit type E3    SCF complex     Ring finger protein      TRV_07648    Cul2 complex      TRV_07648    Cul3 complex      TRV_07648    Cul4 complex      TRV_07648    Cul7 complex      TRV_07648    Cul8 complex      TRV_07648    Cul9 complex      TRV_07648 DNA repair and recombination proteins [BR:tve03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       TRV_07648     TCR (transcription coupled repair) factors      Cul4-CSA complex       TRV_07648 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 Motif Other DBs NCBI-GeneID:  9580037 NCBI-ProteinID:  XP_003018342 UniProt:  D4DKC6 LinkDB All DBs AA seq 66 aa AA seqDB search MADVEMTDAAGDASKGKAVAKTAKADAAGEGKKRFEVKKWNAVALWAWDIIVDNCAICRN HIMDLC NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttgaaatgacggatgctgctggagatgccagcaaggggaaagctgtagct aagaccgcaaaggctgatgcagctggggagggtaagaagagatttgaggtcaaaaagtgg aatgctgttgctctgtgggcatgggatattatcgttgataactgtgctatttgccgaaac cacatcatggacctgtgttag

DBGET integrated database retrieval system