KEGG   Trichosurus vulpecula (common brushtail): 118854783
Entry
118854783         CDS       T10126                                 
Symbol
FGF2
Name
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
tvp  Trichosurus vulpecula (common brushtail)
Pathway
tvp01521  EGFR tyrosine kinase inhibitor resistance
tvp04010  MAPK signaling pathway
tvp04014  Ras signaling pathway
tvp04015  Rap1 signaling pathway
tvp04020  Calcium signaling pathway
tvp04151  PI3K-Akt signaling pathway
tvp04550  Signaling pathways regulating pluripotency of stem cells
tvp04810  Regulation of actin cytoskeleton
tvp05167  Kaposi sarcoma-associated herpesvirus infection
tvp05200  Pathways in cancer
tvp05205  Proteoglycans in cancer
tvp05207  Chemical carcinogenesis - receptor activation
tvp05218  Melanoma
tvp05224  Breast cancer
tvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    118854783 (FGF2)
   04014 Ras signaling pathway
    118854783 (FGF2)
   04015 Rap1 signaling pathway
    118854783 (FGF2)
   04020 Calcium signaling pathway
    118854783 (FGF2)
   04151 PI3K-Akt signaling pathway
    118854783 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    118854783 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    118854783 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118854783 (FGF2)
   05205 Proteoglycans in cancer
    118854783 (FGF2)
   05207 Chemical carcinogenesis - receptor activation
    118854783 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    118854783 (FGF2)
   05218 Melanoma
    118854783 (FGF2)
   05224 Breast cancer
    118854783 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    118854783 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    118854783 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:tvp04052]
    118854783 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:tvp00536]
    118854783 (FGF2)
Cytokines and neuropeptides [BR:tvp04052]
 Cytokines
  Growth factors (RTK binding)
   118854783 (FGF2)
Glycosaminoglycan binding proteins [BR:tvp00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   118854783 (FGF2)
SSDB
Motif
Pfam: FGF IL1
Other DBs
NCBI-GeneID: 118854783
NCBI-ProteinID: XP_036620929
LinkDB
Position
6:complement(137955218..138017118)
AA seq 236 aa
MILAGGRDYGAVRGGEPERGAPLGARAESEPAWGGRLGGRGQGRNQLAARLGGRGRGRAP
LRLAARGARAAAPGPSRSSGMAAGSITTLPALSGDGGSGGAFPPGHFKDPKRLYCKNGGF
FLRIHPDGHVDGIREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLALKCVTE
ECFFFERLESNNYNTYRSRKYSNWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 711 nt   +upstreamnt  +downstreamnt
atgatcttggctggagggcgtgactatggcgctgtgaggggcggggagccagagcgggga
gcccccctcggagcccgagcagagtcggagccggcctggggcgggaggctggggggccgc
gggcagggccggaaccagctggccgcgaggctggggggccgcgggaggggccgcgcccct
ctgcggctggcagctcggggggcccgggccgcggcgccaggcccgtcccgcagcagcggc
atggccgcgggcagcatcaccacgttgccggccctgtccggggatggaggcagcgggggc
gcctttcccccgggccacttcaaggaccccaagcggctgtactgcaagaacgggggcttc
ttcttgcgcatccatcccgatggtcatgtggacggcatccgcgagaagagcgacccgcat
attaaactacaacttcaggcagaagagagaggagtggtgtctattaagggagtatgtgcc
aaccgttatcttgccatgaaggaggatggcagattactggctctgaaatgtgtgaccgaa
gagtgtttcttctttgaacgtctggagtccaacaactacaacacttatcgctcgaggaaa
tattccaattggtacgtggcactgaaacgcactgggcagtacaagcttggatccaagacc
ggaccggggcagaaagccattcttttcctccccatgtctgctaagagttga

DBGET integrated database retrieval system