Ursus arctos (brown bear): 113255907 Help Entry 113255907         CDS       T05909                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism uah  Ursus arctos (brown bear) Pathway uah00510   N-Glycan biosynthesis uah00513   Various types of N-glycan biosynthesis uah04141   Protein processing in endoplasmic reticulum Module uah_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:uah00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     113255907    00513 Various types of N-glycan biosynthesis     113255907  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113255907 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  113255907 NCBI-ProteinID:  XP_044240690 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MELEIMSRYTNPVNLAVFPHPTMVLLATGMFFTAWFFVYEVTSTKCTQDIYKELLISLVA LLFVSSRVLFLLLFLLFQPGSFTEFML NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggagctcgagatcatgagcagatacactaacccagtgaacctggctgtcttcccccat ccaaccatggtgctattggccactggcatgttctttacagcctggttcttcgtttatgag gttacttccaccaagtgcactcaggatatctacaaagagctcctaatctccttggtggcc ttgctcttcgtgagctctagagtcctcttcctgctactcttcctgctgttccaaccaggc agcttcactgaattcatgctttag

DBGET integrated database retrieval system