Ursus arctos (brown bear): 113256300 Help Entry 113256300         CDS       T05909                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism uah  Ursus arctos (brown bear) Pathway uah04010   MAPK signaling pathway uah04014   Ras signaling pathway uah04015   Rap1 signaling pathway uah04024   cAMP signaling pathway uah04062   Chemokine signaling pathway uah04510   Focal adhesion uah04520   Adherens junction uah04611   Platelet activation uah04670   Leukocyte transendothelial migration uah04720   Long-term potentiation uah04722   Neurotrophin signaling pathway uah04934   Cushing syndrome uah04972   Pancreatic secretion uah05211   Renal cell carcinoma uah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113256300 (RAP1B)    04014 Ras signaling pathway     113256300 (RAP1B)    04015 Rap1 signaling pathway     113256300 (RAP1B)    04024 cAMP signaling pathway     113256300 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     113256300 (RAP1B)    04520 Adherens junction     113256300 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     113256300 (RAP1B)    04670 Leukocyte transendothelial migration     113256300 (RAP1B)    04062 Chemokine signaling pathway     113256300 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     113256300 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     113256300 (RAP1B)    04722 Neurotrophin signaling pathway     113256300 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     113256300 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     113256300 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     113256300 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     113256300 (RAP1B)    04031 GTP-binding proteins [BR:uah04031]     113256300 (RAP1B) Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113256300 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    113256300 (RAP1B)   Exosomal proteins of colorectal cancer cells    113256300 (RAP1B) GTP-binding proteins [BR:uah04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     113256300 (RAP1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  113256300 NCBI-ProteinID:  XP_026355866 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKIRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataaactagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttac agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttactgcaatgagagacttatacatgaaaaatggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacagtggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagatccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system