Ursus arctos (brown bear): 113260295 Help Entry 113260295         CDS       T05909                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism uah  Ursus arctos (brown bear) Pathway uah04060   Cytokine-cytokine receptor interaction uah04151   PI3K-Akt signaling pathway uah04217   Necroptosis uah04380   Osteoclast differentiation uah04620   Toll-like receptor signaling pathway uah04621   NOD-like receptor signaling pathway uah04622   RIG-I-like receptor signaling pathway uah04623   Cytosolic DNA-sensing pathway uah04630   JAK-STAT signaling pathway uah04650   Natural killer cell mediated cytotoxicity uah04668   TNF signaling pathway uah04936   Alcoholic liver disease uah05135   Yersinia infection uah05142   Chagas disease uah05152   Tuberculosis uah05160   Hepatitis C uah05161   Hepatitis B uah05162   Measles uah05163   Human cytomegalovirus infection uah05164   Influenza A uah05165   Human papillomavirus infection uah05167   Kaposi sarcoma-associated herpesvirus infection uah05168   Herpes simplex virus 1 infection uah05169   Epstein-Barr virus infection uah05170   Human immunodeficiency virus 1 infection uah05171   Coronavirus disease - COVID-19 uah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     113260295 (IFNB1)    04668 TNF signaling pathway     113260295 (IFNB1)    04151 PI3K-Akt signaling pathway     113260295 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113260295 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     113260295 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113260295 (IFNB1)    04621 NOD-like receptor signaling pathway     113260295 (IFNB1)    04622 RIG-I-like receptor signaling pathway     113260295 (IFNB1)    04623 Cytosolic DNA-sensing pathway     113260295 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     113260295 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     113260295 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     113260295 (IFNB1)    05161 Hepatitis B     113260295 (IFNB1)    05160 Hepatitis C     113260295 (IFNB1)    05171 Coronavirus disease - COVID-19     113260295 (IFNB1)    05164 Influenza A     113260295 (IFNB1)    05162 Measles     113260295 (IFNB1)    05168 Herpes simplex virus 1 infection     113260295 (IFNB1)    05163 Human cytomegalovirus infection     113260295 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     113260295 (IFNB1)    05169 Epstein-Barr virus infection     113260295 (IFNB1)    05165 Human papillomavirus infection     113260295 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     113260295 (IFNB1)    05152 Tuberculosis     113260295 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     113260295 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     113260295 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     113260295 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113260295 (IFNB1) Cytokines and neuropeptides [BR:uah04052]  Cytokines   Interferons    113260295 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  113260295 NCBI-ProteinID:  XP_026361786 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTSRCILQTALLVYFSTTVLAVNYDLLRFQLSSSSVECQELLLQLNGTTKDCLKDRMNFK FPEEIEKSQQFQKEDFILVTLEMFQKTSDIFRRNLSSTGWNEIIVKNLLETLHWQKEHLE EILEKIMEEENFTWDDRTLLHLKKYYLRIVRYLKAKEYSICAWTIVQAEMLRSFFFLDKL TDYLPN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaggtgcatcctccaaaccgctctcctggtgtatttctccaccacggttctc gccgtgaactacgacttgcttcgattccaactaagcagcagcagtgtggagtgccaggag ctccttctgcagttgaatggaacgactaaagattgcctcaaggaccggatgaacttcaag ttccctgaggagatcgagaaatcccagcagttccagaaggaggacttcatattggtcacc cttgagatgttccagaagacctctgatattttcaggagaaatctctcgagcacagggtgg aatgagatcattgtcaagaacctccttgagacgctccattggcagaaggaacatctggag gaaatcctggagaaaatcatggaggaggaaaacttcacctgggacgacaggacccttctg cacctgaagaaatattatctaaggatcgtgcgatacctgaaggccaaggagtacagcatt tgtgcctggacaatagtgcaagcagagatgctcaggagctttttcttccttgataaactt acggattatctcccaaactga

DBGET integrated database retrieval system