Ursus arctos (brown bear): 113261280 Help Entry 113261280         CDS       T05909                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism uah  Ursus arctos (brown bear) Pathway uah01521   EGFR tyrosine kinase inhibitor resistance uah01523   Antifolate resistance uah04060   Cytokine-cytokine receptor interaction uah04061   Viral protein interaction with cytokine and cytokine receptor uah04066   HIF-1 signaling pathway uah04068   FoxO signaling pathway uah04151   PI3K-Akt signaling pathway uah04218   Cellular senescence uah04620   Toll-like receptor signaling pathway uah04621   NOD-like receptor signaling pathway uah04623   Cytosolic DNA-sensing pathway uah04625   C-type lectin receptor signaling pathway uah04630   JAK-STAT signaling pathway uah04640   Hematopoietic cell lineage uah04657   IL-17 signaling pathway uah04659   Th17 cell differentiation uah04668   TNF signaling pathway uah04672   Intestinal immune network for IgA production uah04931   Insulin resistance uah04932   Non-alcoholic fatty liver disease uah04933   AGE-RAGE signaling pathway in diabetic complications uah04936   Alcoholic liver disease uah05010   Alzheimer disease uah05020   Prion disease uah05022   Pathways of neurodegeneration - multiple diseases uah05132   Salmonella infection uah05133   Pertussis uah05134   Legionellosis uah05135   Yersinia infection uah05142   Chagas disease uah05143   African trypanosomiasis uah05144   Malaria uah05146   Amoebiasis uah05152   Tuberculosis uah05161   Hepatitis B uah05162   Measles uah05163   Human cytomegalovirus infection uah05164   Influenza A uah05166   Human T-cell leukemia virus 1 infection uah05167   Kaposi sarcoma-associated herpesvirus infection uah05168   Herpes simplex virus 1 infection uah05169   Epstein-Barr virus infection uah05171   Coronavirus disease - COVID-19 uah05200   Pathways in cancer uah05202   Transcriptional misregulation in cancer uah05321   Inflammatory bowel disease uah05323   Rheumatoid arthritis uah05332   Graft-versus-host disease uah05410   Hypertrophic cardiomyopathy uah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     113261280 (IL6)    04668 TNF signaling pathway     113261280 (IL6)    04066 HIF-1 signaling pathway     113261280 (IL6)    04068 FoxO signaling pathway     113261280 (IL6)    04151 PI3K-Akt signaling pathway     113261280 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     113261280 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     113261280 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     113261280 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     113261280 (IL6)    04620 Toll-like receptor signaling pathway     113261280 (IL6)    04621 NOD-like receptor signaling pathway     113261280 (IL6)    04623 Cytosolic DNA-sensing pathway     113261280 (IL6)    04625 C-type lectin receptor signaling pathway     113261280 (IL6)    04659 Th17 cell differentiation     113261280 (IL6)    04657 IL-17 signaling pathway     113261280 (IL6)    04672 Intestinal immune network for IgA production     113261280 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     113261280 (IL6)    05202 Transcriptional misregulation in cancer     113261280 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     113261280 (IL6)    05161 Hepatitis B     113261280 (IL6)    05171 Coronavirus disease - COVID-19     113261280 (IL6)    05164 Influenza A     113261280 (IL6)    05162 Measles     113261280 (IL6)    05168 Herpes simplex virus 1 infection     113261280 (IL6)    05163 Human cytomegalovirus infection     113261280 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     113261280 (IL6)    05169 Epstein-Barr virus infection     113261280 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     113261280 (IL6)    05135 Yersinia infection     113261280 (IL6)    05133 Pertussis     113261280 (IL6)    05134 Legionellosis     113261280 (IL6)    05152 Tuberculosis     113261280 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     113261280 (IL6)    05144 Malaria     113261280 (IL6)    05142 Chagas disease     113261280 (IL6)    05143 African trypanosomiasis     113261280 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     113261280 (IL6)    05321 Inflammatory bowel disease     113261280 (IL6)    05332 Graft-versus-host disease     113261280 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     113261280 (IL6)    05020 Prion disease     113261280 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     113261280 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     113261280 (IL6)    05410 Hypertrophic cardiomyopathy     113261280 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     113261280 (IL6)    04932 Non-alcoholic fatty liver disease     113261280 (IL6)    04931 Insulin resistance     113261280 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     113261280 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     113261280 (IL6)    01523 Antifolate resistance     113261280 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:uah04052]     113261280 (IL6) Cytokines and neuropeptides [BR:uah04052]  Cytokines   Interleukins    113261280 (IL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 GCSF IL23 IL11 Motif Other DBs NCBI-GeneID:  113261280 NCBI-ProteinID:  XP_026363207 LinkDB All DBs Position Unknown AA seq 240 aa AA seqDB search MRLGMSEAHSALEPTRNERELHLPSRTPAMNSLSTSAFSPVAFSLGLLLVMATAFPTPGH LGRDSKDEATSNRPPLISADKMEIIKYILGRISALKKEMCDKYNKCEDSKEALAENNLHL PKLAEKDGCFQSGFNQDTCLTRIATGLLEFQVHLKYLQANYEGDKENANSVYFSTKVLLQ MLMEKVKNQDEVTTPDPTTDTGLQAILKSQDKWLKQTTIHLILRNLEDFLQFSLRAVRVM NT seq 723 nt NT seq  +upstreamnt  +downstreamnt atgagactggggatgtctgaggctcattctgccctcgagcccaccaggaacgaaagagag ctccatctgccctccaggaccccagctatgaactccctctccacaagcgccttcagtcca gttgccttctccctggggctgctcctggtgatggctactgctttccctaccccgggacac ctgggaagagattccaaagatgaggccacctcaaatagaccaccactcatctctgcagac aaaatggaaatcattaaatacatcctcggcagaatctctgcactgaaaaaggagatgtgt gacaagtataacaagtgtgaagacagcaaggaggcactggcagaaaacaacttacatctt ccaaaactggcagaaaaggacggatgcttccaatctgggttcaatcaggacacctgcctg acaagaatcgctaccggtcttctggagtttcaggtacacctgaaatacctccaggccaac tatgaaggtgataaggaaaatgccaactctgtgtacttcagtaccaaagtcctgctccag atgctgatggaaaaggtaaagaatcaggatgaagtgaccaccccagaccccaccacagac accggcctgcaggctatcctgaagtcgcaggacaagtggctgaagcaaacaacaattcac ctcatcctgcggaaccttgaggatttcctgcagttcagcctgagggcagtgcgggtcatg tag

DBGET integrated database retrieval system