Ursus arctos (brown bear): 113270317 Help Entry 113270317         CDS       T05909                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism uah  Ursus arctos (brown bear) Pathway uah01522   Endocrine resistance uah04010   MAPK signaling pathway uah04024   cAMP signaling pathway uah04210   Apoptosis uah04380   Osteoclast differentiation uah04620   Toll-like receptor signaling pathway uah04657   IL-17 signaling pathway uah04658   Th1 and Th2 cell differentiation uah04659   Th17 cell differentiation uah04660   T cell receptor signaling pathway uah04662   B cell receptor signaling pathway uah04668   TNF signaling pathway uah04713   Circadian entrainment uah04725   Cholinergic synapse uah04728   Dopaminergic synapse uah04915   Estrogen signaling pathway uah04917   Prolactin signaling pathway uah04921   Oxytocin signaling pathway uah04926   Relaxin signaling pathway uah04928   Parathyroid hormone synthesis, secretion and action uah04932   Non-alcoholic fatty liver disease uah04935   Growth hormone synthesis, secretion and action uah05031   Amphetamine addiction uah05132   Salmonella infection uah05133   Pertussis uah05135   Yersinia infection uah05140   Leishmaniasis uah05142   Chagas disease uah05161   Hepatitis B uah05162   Measles uah05166   Human T-cell leukemia virus 1 infection uah05167   Kaposi sarcoma-associated herpesvirus infection uah05170   Human immunodeficiency virus 1 infection uah05171   Coronavirus disease - COVID-19 uah05200   Pathways in cancer uah05207   Chemical carcinogenesis - receptor activation uah05208   Chemical carcinogenesis - reactive oxygen species uah05210   Colorectal cancer uah05224   Breast cancer uah05231   Choline metabolism in cancer uah05235   PD-L1 expression and PD-1 checkpoint pathway in cancer uah05323   Rheumatoid arthritis uah05417   Lipid and atherosclerosis uah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113270317 (FOS)    04668 TNF signaling pathway     113270317 (FOS)    04024 cAMP signaling pathway     113270317 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     113270317 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113270317 (FOS)    04660 T cell receptor signaling pathway     113270317 (FOS)    04658 Th1 and Th2 cell differentiation     113270317 (FOS)    04659 Th17 cell differentiation     113270317 (FOS)    04657 IL-17 signaling pathway     113270317 (FOS)    04662 B cell receptor signaling pathway     113270317 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     113270317 (FOS)    04917 Prolactin signaling pathway     113270317 (FOS)    04921 Oxytocin signaling pathway     113270317 (FOS)    04926 Relaxin signaling pathway     113270317 (FOS)    04935 Growth hormone synthesis, secretion and action     113270317 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     113270317 (FOS)   09156 Nervous system    04725 Cholinergic synapse     113270317 (FOS)    04728 Dopaminergic synapse     113270317 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     113270317 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     113270317 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     113270317 (FOS)    05207 Chemical carcinogenesis - receptor activation     113270317 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     113270317 (FOS)    05231 Choline metabolism in cancer     113270317 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     113270317 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     113270317 (FOS)    05224 Breast cancer     113270317 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     113270317 (FOS)    05170 Human immunodeficiency virus 1 infection     113270317 (FOS)    05161 Hepatitis B     113270317 (FOS)    05171 Coronavirus disease - COVID-19     113270317 (FOS)    05162 Measles     113270317 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     113270317 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     113270317 (FOS)    05135 Yersinia infection     113270317 (FOS)    05133 Pertussis     113270317 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     113270317 (FOS)    05142 Chagas disease     113270317 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     113270317 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     113270317 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     113270317 (FOS)    05418 Fluid shear stress and atherosclerosis     113270317 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     113270317 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     113270317 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:uah03000]     113270317 (FOS)    04131 Membrane trafficking [BR:uah04131]     113270317 (FOS) Transcription factors [BR:uah03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     113270317 (FOS) Membrane trafficking [BR:uah04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     113270317 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  113270317 NCBI-ProteinID:  XP_026375263 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLSDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcccgtcaatgcgcaggacttctgcacggatctggccgtctccagtgccaacttt atcccgacggtgactgccatctccaccagcccggacctgcagtggttggtgcagcccacc ctggtctcctccgtggccccatcccagaccagagccccccacccctatggagtccctacc ccctccgctggggcttactccagggctggagtcgtgaagaccatgacgggaggcagagct cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggccgcagccaagtgccggaaccggaggagggag ctgactgacactctccaagcggagacagaccaactagaagatgagaagtctgctttgcag accgagattgccaacttgctgaaggagaaggaaaaactagagttcatcctggcggctcac cgacctgcctgcaagatccccgacgacctgggcttccccgaagagatgtctgtggcttcc ctagatctgagcgggggcctgcccgaagccgccacccccgagtccgaggaggctttcacc ctgcccctcctcagtgatcctgagcccaagccctccgtggagcccgtcaagagcatcagc agcatggagctgaaggccgagcccttcgatgacttcctgttcccagcgtcgtccaggccc agcggctccgagaccgcccgctccgtgccagacatggacctgtctggttccttctatgca gcggactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg gagcctctgtgcacccccgtggtcacctgtactcccagctgcactacctacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgctcaccgcaag ggcagcagcagcaacgaaccgtcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system