Ursus arctos (brown bear): 123000663 Help Entry 123000663         CDS       T05909                                  Name (RefSeq) ras-related protein Rap-1b-like   KO K07836   Ras-related protein Rap-1B Organism uah  Ursus arctos (brown bear) Pathway uah04010   MAPK signaling pathway uah04014   Ras signaling pathway uah04015   Rap1 signaling pathway uah04024   cAMP signaling pathway uah04062   Chemokine signaling pathway uah04510   Focal adhesion uah04520   Adherens junction uah04611   Platelet activation uah04670   Leukocyte transendothelial migration uah04720   Long-term potentiation uah04722   Neurotrophin signaling pathway uah04934   Cushing syndrome uah04972   Pancreatic secretion uah05211   Renal cell carcinoma uah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:uah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123000663    04014 Ras signaling pathway     123000663    04015 Rap1 signaling pathway     123000663    04024 cAMP signaling pathway     123000663  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     123000663    04520 Adherens junction     123000663  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     123000663    04670 Leukocyte transendothelial migration     123000663    04062 Chemokine signaling pathway     123000663   09154 Digestive system    04972 Pancreatic secretion     123000663   09156 Nervous system    04720 Long-term potentiation     123000663    04722 Neurotrophin signaling pathway     123000663  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     123000663   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123000663   09167 Endocrine and metabolic disease    04934 Cushing syndrome     123000663  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:uah04147]     123000663    04031 GTP-binding proteins [BR:uah04031]     123000663 Exosome [BR:uah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    123000663   Exosomal proteins of other body fluids (saliva and urine)    123000663   Exosomal proteins of colorectal cancer cells    123000663 GTP-binding proteins [BR:uah04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     123000663 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc AAA_16 Motif Other DBs NCBI-GeneID:  123000663 NCBI-ProteinID:  XP_044237549 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MAPAALRWGRKQRPGRSTRRGLVILGSGGTGKSALTIQTEQFTAMRDLYMKSGQGFALVH SITAQFTFNDLQDLREQILHVKDTDDVAAILAGNKCDVEDERFIGKERGQNLARQWNNCA FLESSAKSKININEIFYDLVWQINRKTPVPGKALKKSASQLL NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggcaccagcagcactgcgttggggccggaagcagcgaccaggaaggagcacgaggcgt gggctagtcattcttggctcaggaggcactggaaaatctgctctgactatacagacagaa caatttaccgcaatgagagatttatacatgaaaagcggacaaggctttgcattagttcac tccatcacagcacagttcacatttaatgatttacaagatctgagagagcagattcttcac gttaaagacactgatgatgttgcagcaattctggctggtaataagtgtgacgtggaagat gaaagatttataggaaaggaacgaggtcaaaatctagcaagacaatggaacaactgtgca ttcttagaatcttctgcaaaatcaaaaataaatattaatgagatcttttatgacctagtg tggcaaattaacagaaaaactccagtgcctgggaaggccctcaaaaagtcagcaagtcag ctactttaa

DBGET integrated database retrieval system