Ursus americanus (American black bear): 123777585 Help Entry 123777585         CDS       T07931                                  Symbol CD209 Name (RefSeq) CD209 antigen isoform X1   KO K06563   C-type lectin domain family 4 member L/M Organism uar  Ursus americanus (American black bear) Pathway uar03260   Virion - Human immunodeficiency virus uar03264   Virion - Flavivirus and Alphavirus uar03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus uar03273   Virion - Lassa virus and SFTS virus uar04145   Phagosome uar04625   C-type lectin receptor signaling pathway uar05152   Tuberculosis uar05162   Measles Brite KEGG Orthology (KO) [BR:uar00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     123777585 (CD209)    03264 Virion - Flavivirus and Alphavirus     123777585 (CD209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     123777585 (CD209)    03273 Virion - Lassa virus and SFTS virus     123777585 (CD209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123777585 (CD209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123777585 (CD209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     123777585 (CD209)   09171 Infectious disease: bacterial    05152 Tuberculosis     123777585 (CD209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:uar04131]     123777585 (CD209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:uar04054]     123777585 (CD209)    04515 Cell adhesion molecules [BR:uar04515]     123777585 (CD209)    04090 CD molecules [BR:uar04090]     123777585 (CD209)    04091 Lectins [BR:uar04091]     123777585 (CD209) Membrane trafficking [BR:uar04131]  Endocytosis   Phagocytosis    C-lectin receptors     123777585 (CD209) Pattern recognition receptors [BR:uar04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    123777585 (CD209) Cell adhesion molecules [BR:uar04515]  Lectins   Selectins and C-type lectins    123777585 (CD209) CD molecules [BR:uar04090]  Proteins   123777585 (CD209) Lectins [BR:uar04091]  C-Type lectins   Asialoglycoprotein and DC receptors    123777585 (CD209) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  123777585 NCBI-ProteinID:  XP_045630300 LinkDB All DBs Position Unknown AA seq 249 aa AA seqDB search MAEMCDSKEPGDPEEEMFGGQKVTRKYPGLLRSSRSLSACLTRAQLPLLLLLISLGFFML LVATLVQVSRIHQSLQKETRDHQESPSQVGVSQEPTRSDLEDVLQQLTWMNATLAGLCRP CPWKWELFQGRCYFFSQTQDIWKDAISACQNLRAQLVVINSTEEQKFLKSWNVRNNQRTW IGLSDHHNEGSWKWVDSSPLQLSFWKEGEPNNHGDEDCVELYSDGWNDNRCNTENFWTCE KPSSSCPGS NT seq 750 nt NT seq  +upstreamnt  +downstreamnt atggcagaaatgtgtgactccaaggagccgggggaccccgaggaggagatgtttgggggc cagaaagtgacgaggaaataccctggactgctcaggagctcaaggagcttgtcagcgtgt ctgacccgggcccagttgcctctgctgctgcttctcatctctttgggcttcttcatgctc ctggtggccaccctggttcaagtctccaggatccaccaatccctgcagaaagagacgcgg gaccatcaggagagccccagccaagtgggtgtttctcaggagccgacgcgatcagacctg gaggacgtcctccagcagctaacctggatgaatgccaccctggctggcctgtgccgcccc tgtccctggaaatgggaactcttccagggaagatgctacttcttctcccagacccaggac atctggaaagatgccatttccgcgtgtcagaacttgagggcccagctggtggtcatcaac agtactgaggagcagaaatttctgaagtcttggaatgtgagaaataaccagcgcacctgg atcggcctcagtgaccaccacaatgaggggtcctggaaatgggtggacagctctcccctg caactcagcttctggaaagaaggggaacccaacaaccacggggacgaggactgtgtagaa ttgtacagcgatggctggaatgataacagatgtaatacggaaaacttctggacatgcgag aagccttcgtcctcctgccctggctcctga

DBGET integrated database retrieval system